DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpina6

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001009663.1 Gene:Serpina6 / 299270 RGDID:1595901 Length:396 Species:Rattus norvegicus


Alignment Length:385 Identity:95/385 - (24%)
Similarity:176/385 - (45%) Gaps:44/385 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 DFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINV---EDEKLRG 139
            |||.:|.||:  .....:|:.:|||.|:...|.::   |.|..:.|..:||..|:   .:.::..
  Rat    40 DFAFNLYQRL--VALNPDKNTLISPVSISMALAMV---SLGSAQTQSLQSLGFNLTETSEAEIHQ 99

  Fly   140 AYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNY-RDAIQNYNVQPMEVDFYS-PDSVIQINE 202
            :::..:..|..:.:.:|:....|::..:...:|::: .|..|.|..:.:.:||.. ..:..|||:
  Rat   100 SFQYLNYLLKQSDTGLEMNMGNAMFLLQKLKLKDSFLADVKQYYESEALAIDFEDWTKASQQINQ 164

  Fly   203 DTNRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFF-SESGEVIGKIPMM 266
            .....|:|.|.:.....| ..|...|::.::.:|.|:.||:...||||.|: :|:..|  |:|||
  Rat   165 HVKDKTQGKIEHVFSDLD-SPASFILVNYIFLRGIWELPFSPENTREEDFYVNETSTV--KVPMM 226

  Fly   267 VQEANFAYVSNVEGLDGYVLELPY---GTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRL 328
            ||..:..|..: ......::::.|   ||     ...:||.:| :::.|   :.||. |..:.|.
  Rat   227 VQSGSIGYFRD-SVFPCQLIQMDYVGNGT-----AFFILPDQG-QMDTV---IAALS-RDTIDRW 280

  Fly   329 AAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDL------FDENTANLDRMSSGLFAKL 387
                .:.....:|.:.:|||..:..:.||.:|..:.|:||      |..||.::.      ....
  Rat   281 ----GKLMTPRQVNLYIPKFSISDTYDLKDMLEDLNIKDLLTNQSDFSGNTKDVP------LTLT 335

  Fly   388 VVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            :||...:.:||......:...|.|..::.|.....|:||..::.:|.|...|...||.||
  Rat   336 MVHKAMLQLDEGNVLPNSTNGAPLHLRSEPLDIKFNKPFILLLFDKFTWSSLMMSQVVNP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 91/380 (24%)
Serpina6NP_001009663.1 alpha-1-antitrypsin_like 37..392 CDD:239011 91/380 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.