DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb6e

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:383 Identity:107/383 - (27%)
Similarity:196/383 - (51%) Gaps:29/383 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRI-NVEDEKLRGAYK 142
            |||.:|:.:.   |.::|:...||.|::|.|.::..|:.|.|.:|:.|.|.: |.........::
  Rat    11 FALKVLRVLG---EDSSKNVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYNCNGNGGGDFHQ 72

  Fly   143 VWSSFL---NITTSTIEVATLQAIYTGKGYPIKNNYRDAIQN-YNVQPMEVDFY-SPDSVIQ-IN 201
            .:.|.|   |.:.....:.|..:::....:.|..:::|:.:. |..:...:||. :|:...| ||
  Rat    73 CFQSLLTEVNKSDRRHMLKTSNSVFVEDSFEILASFKDSCRKFYEAEIENMDFKGAPEQSRQHIN 137

  Fly   202 EDTNRTTRGLIPYTILPQDV-YGAKMFLLSSLYFKGQWKFPFNKTLTREEPF-FSESGEVIGKIP 264
            ....:.|..:|...:.|..| ...::.|::|.||||.|:.||||..|||.|| .|::.:.|  :.
  Rat   138 TWVAKKTEDVIRELLSPGTVNSNTQLVLMNSFYFKGNWEKPFNKEDTREMPFKVSKNEKKI--VQ 200

  Fly   265 MMVQEANFAYVSNVEGLDGYVLELPY-GTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRL 328
            ||..::||. ..:||.:...:..||| |.|  |::.::||....:|..|.|.:       ..::|
  Rat   201 MMFNKSNFR-TYHVEDISTTLALLPYLGNQ--LSITIMLPDEYVELRTVENQI-------TYEKL 255

  Fly   329 AAF-RNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSS--GLFAKLVVH 390
            ..: |....::.|||:::|:|.....:.:|.||.::|:.:.|::..|:...:||  |||...|||
  Rat   256 IEWTRLENMQEEEVEILLPRFKLEESYDMKNVLCKLGMTNAFEDGRADFSGISSKPGLFLSKVVH 320

  Fly   391 STKIIVDEQGTTAGAVTE-AALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            .:.:.|:|:||.|.|.|| ..:.:..:|...:.:.||.::|.:.....:||.|:..:|
  Rat   321 KSVVEVNEEGTEAAAPTEIVTMGSPLSPQCLVADHPFLFLIQDDRNKAILFLGRFSSP 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 106/378 (28%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.