DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb8

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001099418.1 Gene:Serpinb8 / 288937 RGDID:1309833 Length:375 Species:Rattus norvegicus


Alignment Length:383 Identity:104/383 - (27%)
Similarity:191/383 - (49%) Gaps:32/383 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYKV 143
            ||:.||:.:..|.:..|..|  .|.||.|.|.::|.|::|.|..|:.:.|.::.:.:..:| ::.
  Rat    11 FAISLLKILGEEDKSRNLFF--CPMSVSSALAMVYLGAKGNTATQMSQVLGLSGDGDVHQG-FQT 72

  Fly   144 WSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQNYNVQPMEVDFYSPDSV---IQINEDTN 205
            ..:.:|.:.:...:.:...::..:.....:.::::.|.:....:|...:..|:.   .:||:...
  Rat    73 LLAEVNKSGTQYLLKSACRLFGEESCDFLSTFKESCQKFYQAGIEEMSFVKDTEGCRKRINDWVL 137

  Fly   206 RTTRG-----LIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPM 265
            ..|.|     |.|.|:.|.    .|:.|::::||||:||..|::..||..||.:...|. ..:.|
  Rat   138 EKTEGKISEVLSPGTVCPL----TKLVLVNAMYFKGKWKAQFDRKYTRGMPFKTNQEEK-KTVQM 197

  Fly   266 MVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAA 330
            |.:.|.|. :::|:.::..||.||| .:|.|:|:|:||.....|..|.   |||    ..::|.|
  Rat   198 MFKHAKFK-MAHVDEVNAQVLALPY-AEDELSMVVLLPDESSDLTVVE---KAL----TYEKLRA 253

  Fly   331 FRN-RASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSS--GLFAKLVVHST 392
            :.| ....:::|:|..|:......:.|:.||..:|:.|.|:|..|:...|:|  .:....|.|..
  Rat   254 WTNPETLTESKVQVFFPRLKLEESYDLETVLQSLGMTDAFEETKADFSGMTSKKNVPVSKVAHKC 318

  Fly   393 KIIVDEQGTTAGAVTEAALANKAT---PPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            .:.|:|:||.|.|.| |.:.|..:   .|:|..:|||.:.|..:.|..:||.|:..:|
  Rat   319 FVEVNEEGTEAAATT-AVIRNTRSCRIEPRFCADRPFLFFIWHQKTSSILFCGRFSSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 103/378 (27%)
Serpinb8NP_001099418.1 SERPIN 4..375 CDD:294093 103/381 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.