DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinf1

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_808788.1 Gene:Serpinf1 / 287526 RGDID:631369 Length:418 Species:Rattus norvegicus


Alignment Length:490 Identity:104/490 - (21%)
Similarity:176/490 - (35%) Gaps:126/490 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LMLWIPLLLGAIFLCSADPQNNQAPLQLSVGNPLTAFTAPTAFQSGVSHIQSMRSNFDTDVLVSI 72
            |:||...|||.....:....:..:|...|.|.|:.....| .|::.|:               .:
  Rat     6 LLLWTGALLGHGSSQNVPDSSQDSPAPDSTGEPVVEEDDP-FFKAPVN---------------KL 54

  Fly    73 SQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRIN-VEDEK 136
            :..|.:|..||.:..|..|...|  .::||.||.:.|..|..|:|..|.:.:.::|..: :.:..
  Rat    55 AAAVSNFGYDLYRLRSGAVSTGN--ILLSPLSVATALSALSLGAEQRTESVIHRALYYDLINNPD 117

  Fly   137 LRGAYK-------------------VWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQNY 182
            :...||                   |:...|.:.:|.  ||.|:..|..:...:..|.|..:|..
  Rat   118 IHSTYKELLASVTAPEKNFKSASRIVFERKLRVKSSF--VAPLEKSYGTRPRILTGNPRIDLQEI 180

  Fly   183 N--VQPMEVDFYSPDSVIQINEDTNRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKT 245
            |  ||            .|:.....|:||.: |..:        .:.||...||||||...|:..
  Rat   181 NNWVQ------------AQMKGKIARSTREM-PSAL--------SILLLGVAYFKGQWATKFDSR 224

  Fly   246 LTREEPFFSESGEVIGKIPMMVQ-EANFAYVSNVEGLD----------------GYVLELPYGTQ 293
            .|..:.|..:....: ::|||.. :|...|     |||                ..:..||....
  Rat   225 KTTLQDFHLDEDRTV-RVPMMSDPKAILRY-----GLDSDLNCKIAQLPLTGSMSIIFFLPLTVT 283

  Fly   294 DRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKG 358
            ..|.||.......| ::|:...||.:                    :..:.:||...:.:..:..
  Rat   284 QNLTMIEESLTSEF-VHDIDRELKTI--------------------QAVLTVPKLKLSYEGDVTN 327

  Fly   359 VLIQMGIRDLFDENTANLDRMSSGLFAKL---------VVHSTKIIVDEQGTTAGAVTEAALANK 414
            .|..|.::.||:          |..|:|:         |.|......:|:|....:..:......
  Rat   328 SLQDMKLQSLFE----------SPDFSKITGKPVKLTQVEHRAAFEWNEEGAGTSSNPDLQPVRL 382

  Fly   415 ATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNPKA 449
            ..|..:.|||||.:::.:..||.|||.|::.:|.:
  Rat   383 TFPLDYHLNRPFIFVLRDTDTGALLFIGRILDPSS 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 90/416 (22%)
Serpinf1NP_808788.1 PEDF 40..415 CDD:239007 93/452 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.