DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and HMSD

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_016881199.1 Gene:HMSD / 284293 HGNCID:23037 Length:217 Species:Homo sapiens


Alignment Length:110 Identity:24/110 - (21%)
Similarity:49/110 - (44%) Gaps:12/110 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 SVWSLLVLLYEGSEGETRNQLKKSL---RINVEDEKLRGAYKVWSSFLNITTSTIEVATLQAIYT 165
            |:.|.|.:::.|::|.|..|:.::|   :|..||..:...::.....:|.|.:...:.|...::.
Human     2 SISSALAMVFMGAKGNTAAQMSQALCFSKIGGEDGDIHRGFQSLLVAINRTDTEYVLRTANGLFG 66

  Fly   166 GKGYPIKNNYRDAI-QNYNVQPMEVDFYSPDSVIQINEDTNRTTR 209
            .|.|.....:.|:. :.|.....::||        :|:....|||
Human    67 EKSYDFLTGFTDSCGKFYQATIKQLDF--------VNDTEKSTTR 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 24/110 (22%)
HMSDXP_016881199.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.