DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb1b

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_766640.1 Gene:Serpinb1b / 282663 MGIID:2445361 Length:382 Species:Mus musculus


Alignment Length:394 Identity:116/394 - (29%)
Similarity:184/394 - (46%) Gaps:47/394 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRI-NVEDEKLRGAYK 142
            |.|:|...:.......|  ...||||:.|.|.:::.|::|.|..||.|:|.. :|||        
Mouse    11 FTLELFHTLKESSPTGN--IFFSPFSISSSLAMVFLGAKGSTAAQLSKTLHFDSVED-------- 65

  Fly   143 VWSSFLNITTSTIEVATLQA---------IYTGKGYPIKNNYRDAIQN-YNVQPMEVDFY--SPD 195
            :.|.|.::|.   ||:.|.|         :|..|.|.....:..:.|. |:.....|||.  |.|
Mouse    66 IHSCFQSLTA---EVSKLGASHTLKLANRLYGEKTYNFLPEFLASTQKMYSADLAAVDFQHASED 127

  Fly   196 SVIQINEDTNRTTRGLIPYTILPQDVYGA--KMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGE 258
            :..:||:.....|.|.|| .:|.:.|..:  |:.|::::||||.|:..|....|...||.....:
Mouse   128 ARKEINQWVKGQTEGKIP-ELLAKGVVDSMTKLVLVNAIYFKGIWEEQFMTRETINAPFRLNKKD 191

  Fly   259 VIGKIPMMVQEAN--FAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGL 321
            . ..:.||.|:..  |.|:|:   |...|||:|| ....|:|:::||:   .:.|.:..||.:..
Mouse   192 T-KTVKMMYQKKKFPFGYISD---LKCKVLEMPY-QGGELSMVILLPE---DIEDESTGLKKIEE 248

  Fly   322 RPILQRLAAFRNRASEDN-EVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSG--L 383
            :..|.:|..:....:..| :|.|.:|:|.....:.|...|..:|::|||....|:|..||..  |
Mouse   249 QLTLGKLHEWTKHENLRNIDVHVKLPRFKMEESYILNSNLCCLGVQDLFSSGKADLSGMSGSRDL 313

  Fly   384 FAKLVVHSTKIIVDEQGTTAGAVTEA---ALANKATPPK--FLLNRPFQYMIVEKATGLLLFAGQ 443
            |...:||.:.:.|:||||.|.|.|..   .|..|...|:  |.::.||.:.|....|..::|.|:
Mouse   314 FVSKIVHKSFVDVNEQGTEAAAATGGIIQVLCEKMPTPQEVFTVDHPFLFFIRHNPTANMIFFGR 378

  Fly   444 VRNP 447
            |.:|
Mouse   379 VCSP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 114/389 (29%)
Serpinb1bNP_766640.1 serpinB1_LEI 1..382 CDD:381028 115/392 (29%)
CARD-binding motif (CBM). /evidence=ECO:0000250|UniProtKB:P30740 352..382 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.