DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpina5

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_766541.2 Gene:Serpina5 / 268591 MGIID:107817 Length:405 Species:Mus musculus


Alignment Length:381 Identity:94/381 - (24%)
Similarity:183/381 - (48%) Gaps:29/381 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINV---EDEKLR 138
            :|||..|.:  ::..|...::...||.||...|.:|..|:..:|:.|:...|.:::   :::||.
Mouse    44 KDFAFRLYR--ALVSESPGQNVFFSPLSVSMSLGMLSLGAGLKTKTQILDGLGLSLQQGQEDKLH 106

  Fly   139 GAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQN-YNVQPMEVDFYSPD-SVIQIN 201
            ..::.........:..::::...|::......|::::..|::. |.......:|.:|: :..|||
Mouse   107 KGFQQLLQRFRQPSDGLQLSLGSALFKDPAVHIRDDFLSAMKTLYMSDTFSTNFGNPEIAKKQIN 171

  Fly   202 EDTNRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMM 266
            ....:.|:|.|...|...|.... |.:::.::||.:|:..|::|.|.:..|........ ::|||
Mouse   172 NYVAKQTKGKIVDFIKDLDSTHV-MIVVNYIFFKAKWQTAFSETNTHKMDFHVTPKRTT-QVPMM 234

  Fly   267 VQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAF 331
            .:|..::|..: :.:...|:.:||  |.....:.:||..| |:..|.:.|....||..|:.....
Mouse   235 NREDGYSYYLD-QNISCTVVGIPY--QGNAIALFILPSEG-KMKQVEDGLDERTLRNWLKMFTKR 295

  Fly   332 RNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSGLFAKL--VVHSTKI 394
            |        :::.:|||.....:.|:.||.::||:|:|..: |:|..::.....||  :||.:.:
Mouse   296 R--------LDLYLPKFSIEATYKLENVLPKLGIQDVFTTH-ADLSGITDHTNIKLSEMVHKSMM 351

  Fly   395 IVDEQGTTAGAVTEAALANKATPP---KFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            .|:|.||||.|:|.|....::..|   |....|||...::|.:.  :||.|:|..|
Mouse   352 EVEESGTTAAAITGAIFTFRSARPSSLKIEFTRPFLLTLMEDSH--ILFVGKVTRP 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 92/376 (24%)
Serpina5NP_766541.2 serpinA5_PCI 42..405 CDD:381021 93/379 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.