DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpina1

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_071964.2 Gene:Serpina1 / 24648 RGDID:3326 Length:411 Species:Rattus norvegicus


Alignment Length:389 Identity:108/389 - (27%)
Similarity:181/389 - (46%) Gaps:36/389 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ISQGVQDFALDLLQRISVEVEKAN-KDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRIN---V 132
            ||..:.|||..|.:.:   |.::| .:...||.|:.:...:|..||:|:||.|:.:.|..|   :
  Rat    44 ISSNLADFAFSLYREL---VHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQI 105

  Fly   133 EDEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQ-NYNVQPMEVDFY-SPD 195
            .:..:..|:......||...|.:::.|...::..|...:...:.:.:: ||:.:...|:|. |.:
  Rat   106 PEADIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEE 170

  Fly   196 SVIQINEDTNRTTRGLIPYTI--LPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGE 258
            :...||:...:.|:|.|...:  |.:|...|   |::.::|||:||.|||...||:..|..:...
  Rat   171 AKKVINDYVEKGTQGKIVDLMKQLDEDTVFA---LVNYIFFKGKWKRPFNPEHTRDADFHVDKST 232

  Fly   259 VIGKIPMMVQEANF--AYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNL-KALG 320
            .: |:|||.:...|  .|.|.   |..:||.:.|  ......|.:||..| |:..:...| |.|.
  Rat   233 TV-KVPMMNRLGMFDMHYCST---LSSWVLMMDY--LGNATAIFLLPDDG-KMQHLEQTLTKDLI 290

  Fly   321 LRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSGLFA 385
            .|.:|.|         :.....:..||...:..:.||.:|..:||..:|: |.|:|..::.....
  Rat   291 SRFLLNR---------QTRSAILYFPKLSISGTYNLKTLLSSLGITRVFN-NDADLSGITEDAPL 345

  Fly   386 KL--VVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            ||  .||...:.:||:||.|...|.......:.||:...:.||.:||||..|...||.|:|.:|
  Rat   346 KLSQAVHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKFDHPFIFMIVESETQSPLFVGKVIDP 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 104/381 (27%)
Serpina1NP_071964.2 alpha-1-antitrypsin_like 49..406 CDD:239011 104/379 (27%)
RCL 367..386 3/18 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.