DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpine1

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_036752.2 Gene:Serpine1 / 24617 RGDID:3249 Length:402 Species:Rattus norvegicus


Alignment Length:462 Identity:112/462 - (24%)
Similarity:195/462 - (42%) Gaps:77/462 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKIADCLMLWIPLLLGAIFLCSADPQNNQAPLQLSVGNPLTAFTAPTAFQSGVSHIQSMRSNFD 65
            |.....||.|.:.|:.|..|                 .:||..           ||.....:||.
  Rat     3 MSSALTCLTLGLVLVFGKGF-----------------ASPLPE-----------SHTAQQATNFG 39

  Fly    66 TDVLVSISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRI 130
            ..|...:.|..:|                 ::.:.||:.|.|:|.:|...:.|:||.|::.::..
  Rat    40 VKVFQHVVQASKD-----------------RNVVFSPYGVSSVLAMLQLTTAGKTRQQIQDAMGF 87

  Fly   131 NVEDEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYR-DAIQNYNVQPMEVDFYSP 194
            |:.:.....|.:..|..|..:.:..|::|..||:..:...:...:. ...:.:.....:|||...
  Rat    88 NISERGTAPALRKLSKELMGSWNKNEISTADAIFVQRDLELVQGFMPHFFKLFRTTVKQVDFSEM 152

  Fly   195 DSV-IQINEDTNRTTRGLIPYTILPQDVYG--AKMFLLSSLYFKGQWKFPFNKTLTREEPFFSES 256
            :.. ..||:...|.|:|:|. .:|.:....  .::.|:::|||.||||.||.:..|.:..|....
  Rat   153 ERARFIINDWVERHTKGMIS-DLLAKGAVNELTRLVLVNALYFNGQWKTPFLEASTHQRLFHKSD 216

  Fly   257 GEVIGKIPMMVQEANFAYV--SNVEGLDGYVLELPYGTQDRLAMIVVLP-KRGFKLNDVANNLKA 318
            |..| .:|||.|...|.|.  :..:|.:..:||||| ..:.|:|.:..| ::...|:.:.|.|.|
  Rat   217 GSTI-SVPMMAQNNKFNYTEFTTPDGHEYDILELPY-HGETLSMFIAAPFEKDVPLSAITNILDA 279

  Fly   319 LGLR------PILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLD 377
            ..:|      ..|.||              :::|||...|:..|:|.|.::|:.|:|....|:..
  Rat   280 ELIRQWKSNMTRLPRL--------------LILPKFSLETEVDLRGPLEKLGMTDIFSSTQADFT 330

  Fly   378 RMS--SGLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATGLLLF 440
            .:|  ..|.....:...||.|:|.||.|.:.|...::.:..|.:.:|:|.|.:::....|..:||
  Rat   331 SLSDQEQLSVAQALQKVKIEVNESGTVASSSTAILVSARMAPTEMVLDRSFLFVVRHNPTETILF 395

  Fly   441 AGQVRNP 447
            .||:..|
  Rat   396 MGQLMEP 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 95/383 (25%)
Serpine1NP_036752.2 serpin 29..402 CDD:422956 102/406 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.