DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb10

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_006529660.1 Gene:Serpinb10 / 241197 MGIID:2138648 Length:382 Species:Mus musculus


Alignment Length:277 Identity:75/277 - (27%)
Similarity:125/277 - (45%) Gaps:38/277 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LLYEGSEGETRNQLKKSLRI-NVED-------EKLR------GAY-KVWSSFLNITTSTIE---- 156
            ::|.|::|.|.:|:.:.|:. :|||       ||.|      |.: ::.|.|..:....::    
Mouse     1 MVYLGTKGTTADQMAQVLQFSSVEDFKSCPDSEKKRKMEFNSGKFEEIQSDFQTLAAEILKPGNS 65

  Fly   157 --VATLQAIYTGKGYPIKNNYRDAIQNY-NVQPMEVDFYSPDSVI--QINEDTNRTTRGLIPYTI 216
              :.|...||..|.||..|.|.:.::.| ..:|..|:|......|  :||......|.|.|| .:
Mouse    66 YVLKTANRIYGEKTYPFHNKYLEDMKTYFGAEPQSVNFVEASGQIRKEINSWVGSQTGGKIP-NL 129

  Fly   217 LPQDVYG--AKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEANFAYVSNVE 279
            ||.|...  .||.|:::|||||.|:..|:...|.|.||  ...:...|...|:.......|.::|
Mouse   130 LPDDSVDTKTKMVLVNALYFKGTWEHQFSVKSTTERPF--RVNKTTSKPVQMMSMKQSLQVFHIE 192

  Fly   280 GLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDN-EVEV 343
            .|....|:|.|..:| |:::::||       :..:.|:.|......::|..:.:....|. ||::
Mouse   193 ELQTIGLQLHYQNRD-LSLLLLLP-------EAIDGLEQLERAITYEKLDKWTSADMMDTYEVQL 249

  Fly   344 MMPKFVTATDFTLKGVL 360
            .:|||.....:.||..|
Mouse   250 YLPKFKMEESYDLKSAL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 75/277 (27%)
Serpinb10XP_006529660.1 serpin 1..>277 CDD:393296 75/277 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.