DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb6d

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001070258.1 Gene:Serpinb6d / 238568 MGIID:2667783 Length:375 Species:Mus musculus


Alignment Length:373 Identity:105/373 - (28%)
Similarity:183/373 - (49%) Gaps:34/373 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRIN--VED--EKLRG 139
            ||..||:.:.   :..:|:..:||.|:.|.|.:...|::..|..|::::|.::  ..|  |.:..
Mouse    11 FAFKLLKALD---DDTSKNIFLSPPSIASSLAMTLLGAKENTARQIRQTLSLDKCSSDPCEDIHQ 72

  Fly   140 AYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQN-YNVQPMEVDFY--SPDSVIQIN 201
            .:.:..:.:|.|...|.:.|...::..|.:.||.:::||.|. |..:..|:||.  :..|...||
Mouse    73 DFHLLLNEVNKTDPGIILKTENRLFVEKTFHIKKSFKDASQKFYKAEIEELDFKGDTEQSRQHIN 137

  Fly   202 EDTNRTTRGLIPYTILPQDV-YGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPM 265
            ....:.|...|...:.|..| ...::.|::..||||.|:.||||..|||.| |..|..|:..:.|
Mouse   138 TWVTKNTDEKIKDLLSPGSVNSNTRLVLVNDFYFKGYWEKPFNKEDTREMP-FRVSKNVVKPVQM 201

  Fly   266 MVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAA 330
            |.|::.|. ::.:|.:...:|.||| ..::|.||::||       |....|:.|..:...::...
Mouse   202 MFQKSTFK-ITYIEEISTKILLLPY-AGNKLNMIIMLP-------DEHVELRMLEKKMTYEKFVE 257

  Fly   331 FR--NRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSS--GLFAKLVVHS 391
            :.  ::.:|: ||||.:|:|.....:.:..||.:||:.|.|:|..|:...:||  |||...|::.
Mouse   258 WTSLDKMNEE-EVEVFLPRFKLEEIYDMNNVLYKMGMTDAFEEGRADFSGISSKQGLFLSKVIYK 321

  Fly   392 TKIIVDEQGTTAGAVTEAALANKA-TPPKFLLNRPF-------QYMIV 431
            ..|.|.|:||...|.|:..:...: |...|..:.||       .:||:
Mouse   322 AFIEVIEKGTKVAAATDIVMMGASPTTHTFCADHPFIFTHMTEDFMII 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 105/373 (28%)
Serpinb6dNP_001070258.1 SERPIN 4..375 CDD:294093 105/373 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.