DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpina3j

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001094942.1 Gene:Serpina3j / 238395 MGIID:2182843 Length:420 Species:Mus musculus


Alignment Length:444 Identity:103/444 - (23%)
Similarity:195/444 - (43%) Gaps:57/444 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AIFLCSADPQNNQAPLQLSVGNPLTAFTAPTAFQSGVSHIQSMRSNFDTDVLVSISQGVQDFALD 82
            |:..|..|......|:|..                     :...:..|:..|.||:   .|||..
Mouse    17 AVLCCPEDTLGKHTPVQKD---------------------RDHETQLDSLTLASIN---TDFAFS 57

  Fly    83 LLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYKVWSSF 147
            |.::::  ::..:|:|:.||.|:...|..|..|::|.|..::.:.|:.|:.:......::.:...
Mouse    58 LYKKLA--LKNPHKNFVFSPLSITIALASLSLGAKGNTLEEILEGLKFNLTETPEADIHQGFGHL 120

  Fly   148 LNITT---STIEVATLQAIYTGKGYPIKNNYRD-AIQNYNVQPMEVDFYSPDSVIQ-INEDTNRT 207
            |...:   ..::::|..::...|...|...::: |...|:.:....||..|....: :|:..:..
Mouse   121 LQRLSQPGDQVQISTGNSMVVEKHLQILAEFKEKARALYHTEVFTADFQQPREARKLLNDYVSNQ 185

  Fly   208 TRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPF---FSESGEVIGKIPMM-VQ 268
            |:|:|...:...: ....|.:.:...|.|:|    |.|....|.|   |.|......|:.|| ::
Mouse   186 TQGMIKELVSDLE-ERTSMVMTNFALFNGKW----NMTFDPYETFMGTFIEDRRTPVKVSMMKMK 245

  Fly   269 EANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRN 333
            |....|..: |.:...|:||.|....: ||. :||.:| |:..|..:|:...||...:.|   |.
Mouse   246 ELRAPYFRD-EKMKCTVVELNYKGNGK-AMF-ILPDQG-KMKQVEASLQPATLRGWRKSL---RP 303

  Fly   334 RASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSGLFAKL--VVHSTKIIV 396
            |..:    |:.:|||..:.::.|:.:|.::||:::| ...|:|..:|.|...::  :.||..:.:
Mouse   304 RMID----ELYLPKFSISKNYRLENILPELGIKEVF-STQADLSGISGGKDVRVSRMFHSAALDM 363

  Fly   397 DEQGTTAGAVTEAA---LANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            .|.||.|.|.|...   |:.|:.|....||.||.:.::...:..:.|.|::.||
Mouse   364 TETGTEARATTRDKYDFLSTKSNPTVVNLNTPFLFCVLHSDSENIDFMGKINNP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 92/382 (24%)
Serpina3jNP_001094942.1 serpinA3_A1AC 37..417 CDD:381019 96/401 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.