DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpina3f

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001028507.2 Gene:Serpina3f / 238393 MGIID:2182838 Length:445 Species:Mus musculus


Alignment Length:436 Identity:112/436 - (25%)
Similarity:202/436 - (46%) Gaps:56/436 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AFTAPTAF---------QSGVSHIQSMRSNFDTDVLVSISQGVQDFALDLLQRISVEVEKANKDF 98
            |..:|..|         .:.|..:|...::.|:..|.|.:   .|||..|.:.:  .::..:::.
Mouse     2 AGVSPAVFGCPDVTLGRNTAVREVQENITSVDSLTLASSN---TDFAFSLYKEL--VLKNPDENV 61

  Fly    99 MISPFSVWSLLVLLYEGSEGETRNQLKKSLRINV---EDEKLRGAYKVWSSFLNITTSTIEVATL 160
            :.||||:.:.|.||..|::..|..::.:.|:.|:   .:..:...::.....|:...:.::::|.
Mouse    62 VFSPFSICTALALLSLGAKSNTLKEILEGLKFNLTETPEPDIHQGFRYLLDLLSQPGNQVQISTG 126

  Fly   161 QAIYTGKGYPIKNNYRD-AIQNYNVQPMEVDFYSP-DSVIQINEDTNRTTRGLIPYTILPQDVYG 223
            .|::..|...|...::: |...|..:....||..| ::...||:..:..|:|.|...|...| ..
Mouse   127 SALFIEKHLQILAEFKEKARALYQAEAFTADFQQPLEATKLINDYVSNHTQGKIKELISDLD-KR 190

  Fly   224 AKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMM-VQEANFAYVSNVEGLDGYVLE 287
            ..|.|::.:||||:|:.||:...|.:..|:.:....: |:||| :......|..: |.|...|:|
Mouse   191 TLMVLVNYIYFKGKWEMPFDPDDTCKSEFYLDENRSV-KVPMMKINNLTTPYFRD-EELSCTVVE 253

  Fly   288 LPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLR----PILQRLAAFRNRASEDNEVEVMMPKF 348
            |.| |.:..||. :||.:| |:..|..:|:...||    .:..||..           |:.:|||
Mouse   254 LKY-TGNASAMF-ILPDQG-KMQQVEASLQPETLRNWKDSLKPRLIN-----------ELCLPKF 304

  Fly   349 VTATDFTLKGVLIQMGIRDLFDENTANLDRM--SSGLFAKLVVHSTKIIVDEQGTTAGAVT---- 407
            ..:||::|:.:|.::|||:|| ...|:|..:  :..|....|||...:.|.|.||.|.|.|    
Mouse   305 SISTDYSLEHILPELGIRELF-STQADLSAITGTKDLRTSQVVHKAVLDVAETGTEAAAGTGYQN 368

  Fly   408 ----EAALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNPKA 449
                :..:.:.    |...:|||..:|.:..|.:.||..:|.||::
Mouse   369 LQCCQGVIYSM----KIYFDRPFLMIISDTNTHIALFMAKVSNPES 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 101/388 (26%)
Serpina3fNP_001028507.2 alpha-1-antitrypsin_like 40..405 CDD:239011 101/391 (26%)
RCL 357..382 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.