DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb8

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_035589.1 Gene:Serpinb8 / 20725 MGIID:894657 Length:374 Species:Mus musculus


Alignment Length:396 Identity:105/396 - (26%)
Similarity:193/396 - (48%) Gaps:45/396 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEK 136
            :|:....||:.||:.:| |.:| :::....|.||.|.|.::|.|::|.|..|:.:.|       .
Mouse     4 LSEANGSFAISLLKILS-EKDK-SRNLFFCPMSVSSALAMVYLGAKGNTATQMSEVL-------G 59

  Fly   137 LRGAYKVWSSF------LNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQNYNVQPMEVDFYSPD 195
            |.|...|..||      :|.|.:...:.:...::..:.....:.::::...:....:|...::.|
Mouse    60 LSGNGDVHQSFQTLLAEINKTDTQYLLKSACRLFGEESCDFLSTFKESCHKFYQAGLEELSFAKD 124

  Fly   196 SV---IQINEDTNRTTRG-----LIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPF 252
            :.   ..||:..:..|.|     |.|.|:.|.    .|:.|::::||||:||..|::..||..||
Mouse   125 TEGCRKHINDWVSEKTEGKISEVLSPGTVCPL----TKLVLVNAMYFKGKWKAQFDRKYTRGMPF 185

  Fly   253 FSESGEVIGKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLK 317
              ::.:....:.||.:.|.|. :.:|:.::..||.||| .::.|:|:::||...   .|:|...|
Mouse   186 --KTNQEKKTVQMMFKHAKFK-MGHVDEVNMQVLALPY-AEEELSMVILLPDES---TDLAVVEK 243

  Fly   318 ALGLRPILQRLAAFRN-RASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSS 381
            ||    ..::|.|:.| ....:::|:|.:|:......:.|:.||..:|:.|.|:|..|:...|::
Mouse   244 AL----TYEKLRAWTNPETLTESQVQVFLPRLKLEESYDLETVLQNLGMTDAFEETRADFSGMTT 304

  Fly   382 --GLFAKLVVHSTKIIVDEQGTTAGAVTEAALANK---ATPPKFLLNRPFQYMIVEKATGLLLFA 441
              .:....|.|...:.|:|:||.|.|.| |.:.|.   .|.|:|..:.||.:.|....|..:||.
Mouse   305 KKNVPVSKVAHKCFVEVNEEGTEAAAAT-AVIRNARCCRTEPRFCADHPFLFFIWHHKTSSILFC 368

  Fly   442 GQVRNP 447
            |:..:|
Mouse   369 GRFSSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 103/388 (27%)
Serpinb8NP_035589.1 SERPIN 4..374 CDD:294093 104/394 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.