DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpina3n

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_033278.2 Gene:Serpina3n / 20716 MGIID:105045 Length:418 Species:Mus musculus


Alignment Length:402 Identity:108/402 - (26%)
Similarity:188/402 - (46%) Gaps:38/402 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SNFDTDVLVSISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKK 126
            :..|:..|.||:   .|||..|.:.:  .::..:|:.:.||.|:.:.|.::..|::|.|..::.:
Mouse    40 TQLDSLTLASIN---TDFAFSLYKEL--VLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILE 99

  Fly   127 SLRINVEDEKLRGAYKVWSSF---LNITTSTIEVATLQAIYTGKGYPIKNNYRD-AIQNYNVQPM 187
            .|:.|:.:......::.:...   ||.....::::|..|::..|...|...::: |...|..:..
Mouse   100 GLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKARALYQAEAF 164

  Fly   188 EVDFYSPDSVIQ-INEDTNRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEP 251
            ..||..|....: ||:...:.|:|:|...:...| ....|.|::.:|||.:||.||:...|.:..
Mouse   165 TADFQQPRQAKKLINDYVRKQTQGMIKELVSDLD-KRTLMVLVNYIYFKAKWKVPFDPLDTFKSE 228

  Fly   252 FFSESGEVIGK-----IPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLND 311
            |::      ||     :|||..|.........|.|...|:||.| |.:..||. :||.:| |:..
Mouse   229 FYA------GKRRPVIVPMMSMEDLTTPYFRDEELFCTVVELKY-TGNASAMF-ILPDQG-KMQQ 284

  Fly   312 VANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANL 376
            |..:|:.       :.|..::|........|:.:|||..:||::|:.||.::|||::| ...|:|
Mouse   285 VEASLQP-------ETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVF-STQADL 341

  Fly   377 DRM--SSGLFAKLVVHSTKIIVDEQGTTAGAVTE---AALANKATPPKFLLNRPFQYMIVEKATG 436
            ..:  :..|....|||...:.|.|.||.|.|.|.   ..::.|..|.....||||..||.:..|.
Mouse   342 SAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETE 406

  Fly   437 LLLFAGQVRNPK 448
            :..|..::.|||
Mouse   407 IAPFIAKIANPK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 101/383 (26%)
Serpina3nNP_033278.2 serpinA3_A1AC 37..418 CDD:381019 106/400 (27%)
RCL 367..392 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.