DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpina3g

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_033277.2 Gene:Serpina3g / 20715 MGIID:105046 Length:440 Species:Mus musculus


Alignment Length:433 Identity:111/433 - (25%)
Similarity:201/433 - (46%) Gaps:53/433 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AFTAPTAF---------QSGVSHIQSMRSNFDTDVLVSISQGVQDFALDLLQRISVEVEKANKDF 98
            |..:|..|         .:.|..:|...::.|:..|||.:   .|||..|.:::  .::..:::.
Mouse     2 AGVSPAVFGCPDVTLGRNTAVREVQENVTSVDSLTLVSSN---TDFAFSLYRKL--VLKNPDENV 61

  Fly    99 MISPFSVWSLLVLLYEGSEGETRNQLKKSLRINV---EDEKLRGAYKVWSSFLNITTSTIEVATL 160
            :.||||:.:.|.||..|::..|..::.:.|:.|:   .:..:...::.....|:...:.::::|.
Mouse    62 VFSPFSICTALALLSLGAKSNTLKEILEGLKFNLTETPEPDIHQGFRYLLDLLSQPGNQVQISTG 126

  Fly   161 QAIYTGKGYPIKNNYRD-AIQNYNVQPMEVDFYSPDSVIQ-INEDTNRTTRGLIPYTILPQDVYG 223
            .|::..|...|...::: |...|..:....||..|....: ||:..:..|:|.|     .|.:.|
Mouse   127 SALFIEKHLQILAEFKEKARALYQAEAFTADFQQPLKATKLINDYVSNHTQGKI-----KQLISG 186

  Fly   224 AK----MFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEANFAYVSNV----EG 280
            .|    |.|::.:||||:||.||:...|.:..|:.:.     |..::|......|::..    |.
Mouse   187 LKESMLMVLVNYIYFKGKWKNPFDPNDTFKSEFYLDE-----KRSVIVSMMKTGYLTTPYFRDEE 246

  Fly   281 LDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMM 345
            |...|:||.| |.:..||. :||.:| ::..|..:|:.       :.|..::|........|:.:
Mouse   247 LSCTVVELKY-TGNASAMF-ILPDQG-RMQQVEASLQP-------ETLRKWKNSLKPRMIHELRL 301

  Fly   346 PKFVTATDFTLKGVLIQMGIRDLFDENTANLDRM--SSGLFAKLVVHSTKIIVDEQGTTAGAVTE 408
            |||..:||::|:.:|.::|||::| ...|:|..:  :..|....|||...:.|.|:||.|.|.|.
Mouse   302 PKFSISTDYSLEHILPELGIREVF-STQADLSAITGTKDLRVSQVVHKAVLDVAEKGTEAAAATG 365

  Fly   409 AALANKATPPKFL---LNRPFQYMIVEKATGLLLFAGQVRNPK 448
            .|.........||   .||||..:|.:....:.||..:|.||:
Mouse   366 MAGVGCCAVFDFLEIFFNRPFLMIISDTKAHIALFMAKVTNPE 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 99/386 (26%)
Serpina3gNP_033277.2 SERPIN 46..407 CDD:214513 97/383 (25%)
RCL 357..382 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.