DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpini1

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_033276.1 Gene:Serpini1 / 20713 MGIID:1194506 Length:410 Species:Mus musculus


Alignment Length:373 Identity:102/373 - (27%)
Similarity:187/373 - (50%) Gaps:36/373 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 NKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGA--YKVWSSFLNITTS---- 153
            :::.:.||.|:...:.::..|::|.||.:::.|:..    |.|:|.  :.....|.|:.::    
Mouse    43 DENILFSPLSIALAMGMMELGAQGSTRKEIRHSMGY----EGLKGGEEFSFLRDFSNMASAEENQ 103

  Fly   154 -TIEVATLQAIYTGKGYPIKNNYRDAIQNY-NVQPMEVDFYSPDSVI-QINEDTNRTTRGLIPYT 215
             .:::|  .:::...|:.:...:...::.| |.:...|||....:|. .||:.....|..|:...
Mouse   104 YVMKLA--NSLFVQNGFHVNEEFLQMLKMYFNAEVNHVDFSQNVAVANSINKWVENYTNSLLKDL 166

  Fly   216 ILPQDVYG-AKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEANFAY----- 274
            :.|:|..| ..:.|::::||||.||..|....||...|..:....: :||||.|:..|.|     
Mouse   167 VSPEDFDGVTNLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEV-QIPMMYQQGEFYYGEFSD 230

  Fly   275 VSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDN 339
            .||..|....|||:|| ..|.::|::.|.::...|..:...|||       |.:..:.|...: .
Mouse   231 GSNEAGGIYQVLEIPY-EGDEISMMLALSRQEVPLATLEPLLKA-------QLIEEWANSVKK-Q 286

  Fly   340 EVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMS--SGLFAKLVVHSTKIIVDEQGTT 402
            :|||.:|:|....:..||.:|..:|:.::|.:: |||..||  ..||....||.:.|.|:|:|:.
Mouse   287 KVEVYLPRFTVEQEIDLKDILKALGVTEIFIKD-ANLTAMSDKKELFLSKAVHKSCIEVNEEGSE 350

  Fly   403 AGAVT-EAALANKAT-PPKFLLNRPFQYMIVEKATGLLLFAGQVRNPK 448
            |.|.: ..|::..|. .|:.:::.||.|:|..:.:|::||.|:|.||:
Mouse   351 AAAASGMIAISRMAVLYPQVIVDHPFLYLIRNRKSGIILFMGRVMNPE 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 99/367 (27%)
Serpini1NP_033276.1 neuroserpin 23..410 CDD:239003 102/373 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.