DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb6b

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_035584.1 Gene:Serpinb6b / 20708 MGIID:894688 Length:377 Species:Mus musculus


Alignment Length:383 Identity:112/383 - (29%)
Similarity:197/383 - (51%) Gaps:30/383 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYKV 143
            |||:||:.:.   |.::::.:.||.||.|.|.:::.|::|.|.:|:.::|.::....|  |...|
Mouse    11 FALNLLKTLG---EDSSRNVLFSPISVSSALAMVFMGAKGTTASQMAQALSLDKCSGK--GGRDV 70

  Fly   144 WSSFLNITTSTIEVATLQAIYTG------KGYPIKNNYRDAIQN-YNVQPMEVDF--YSPDSVIQ 199
            ...|.::.|.|.:..|...:.|.      |.:.|..:::|:.:. |..:..|:||  .:..|...
Mouse    71 HQGFQSLLTETNKTGTQYVLRTANRLFGEKTFDILASFKDSCRKFYEAEMEELDFKGATEQSRQH 135

  Fly   200 INEDTNRTTRGLIPYTILPQDV-YGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKI 263
            ||....:.|...|...:....| ....:.|::::||||.|:..|||..|:|.| |:.:.:|:..:
Mouse   136 INAWVAKKTEDKITELLSSGSVNSNTPLVLVNAIYFKGNWEKQFNKEDTQEMP-FNVTKDVVKPV 199

  Fly   264 PMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQ-- 326
            .||.|::.|. ::.||.:...:|.||| ..:.|.||::||....:|:.|.   |.:..:..::  
Mouse   200 QMMFQKSTFK-MTYVEEISTNILLLPY-VGNELNMIIMLPDEHIELSMVE---KEITYKKFIEWT 259

  Fly   327 RLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSS--GLFAKLVV 389
            ||...     |:.||||.:|||....::.:|.||.::|:.|.|:|..|:...::|  |||...|:
Mouse   260 RLDKM-----EEEEVEVFLPKFKLEENYDMKDVLCRLGMTDAFEEGMADFSGIASKEGLFLSKVI 319

  Fly   390 HSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            |.:.:.|:|:||.|.|.|.|.:..:...|.|..|.||.:.|....|..::|.|:..:|
Mouse   320 HKSFVEVNEEGTEAAAATAANIGFRCMVPYFCANHPFLFFIQHSRTSGIVFCGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 111/378 (29%)
Serpinb6bNP_035584.1 serpin 1..377 CDD:393296 111/381 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.