DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb9c

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_006516681.1 Gene:Serpinb9c / 20707 MGIID:894669 Length:403 Species:Mus musculus


Alignment Length:395 Identity:105/395 - (26%)
Similarity:176/395 - (44%) Gaps:55/395 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYKV 143
            ||::||:.:.  ....:|:...||.::.|.|.:...|.:|.|..|:.:::.:|.       |..:
Mouse    38 FAVNLLRMLC--NNNPSKNVCYSPINISSALAMFLLGVKGNTEIQISEAIGLNT-------AIDI 93

  Fly   144 WSSF---LNITTS-----TIEVA-------TLQAIYTGKGYPIKNNYRDAIQNYNVQPMEVDF-Y 192
            ..||   |||...     |..:|       |.:.:.|.|        ...:|.|:.:...:.| .
Mouse    94 HQSFLWILNILKKPTRKYTFRMANRLFAENTCEFLPTFK--------EPCLQFYHWEMEHLPFTK 150

  Fly   193 SPDSV-IQINEDTNRTTRGLIPYTILPQDVYG-AKMFLLSSLYFKGQWKFPFNKTLTREEPFFSE 255
            :|:.. ..||....:.|:|.||..:....|.. .::.|:::|||||:|...|:...||:.||...
Mouse   151 APEEARNHINTWVCKNTKGKIPELLSSGSVDSETRLVLVNALYFKGRWHHQFDIKSTRKMPFKIN 215

  Fly   256 SGEVIGKIPMMVQEANF--AYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKA 318
            ..|. ..:.||.||..|  |||:.|:   ..||.|||..:: |:::|:||..|.:|:.|..||  
Mouse   216 KDEE-RPVQMMFQEDMFKLAYVNEVQ---VQVLVLPYKGKE-LSLVVLLPDDGVELSKVEGNL-- 273

  Fly   319 LGLRPILQRLAAF-RNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMS-- 380
                 ..::|:|: :....:..:|.|.:|||.....:.::.:...:|:.|:|....|:|..||  
Mouse   274 -----TFEKLSAWTKPDYLKTTKVLVFLPKFKLEDYYDMESIFQDLGVGDIFQGGKADLSEMSPE 333

  Fly   381 SGLFAKLVVHSTKIIVDEQGTTAGAVT---EAALANKATPPKFLLNRPFQYMIVEKATGLLLFAG 442
            .||.....:....:.|:|:||.|.|.|   ....|.......|..:.||.:.|....|..:||.|
Mouse   334 RGLCVSKFIQKCVVEVNEEGTEATAATADDTVCSAETHDGQTFCADHPFLFFIRHNKTNSILFCG 398

  Fly   443 QVRNP 447
            :...|
Mouse   399 RFSFP 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 104/390 (27%)
Serpinb9cXP_006516681.1 serpin 28..403 CDD:393296 104/393 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.