DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb9b

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_035582.1 Gene:Serpinb9b / 20706 MGIID:894668 Length:377 Species:Mus musculus


Alignment Length:390 Identity:107/390 - (27%)
Similarity:191/390 - (48%) Gaps:28/390 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDE 135
            ::|:....||:.||:.:.  ....:|:...||.|:.|.|.::..|::.:|..|:.::|.:..|..
Mouse     3 TLSEANGTFAIHLLKMLC--QSNPSKNVCFSPVSISSALAMVLLGAKEQTAVQISQALGLKKEKG 65

  Fly   136 KLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDA-IQNYNVQPMEVDFY--SPDSV 197
            ..:|..|:... ||.......:.....::..|...:...:::: .:.|:.:..:|:|:  :.:|.
Mouse    66 IHQGFLKLLRK-LNKPDRKYSLIVANRLFADKTCEVLQTFKESCFRFYDSEMEQVNFFKAAVESR 129

  Fly   198 IQINEDTNRTTRGLIPYTILPQDV-YGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIG 261
            ..||...::.|.|.||..:....| :..::.|:::|||||.|...|.|..|||.||:....|   
Mouse   130 QCINTWVSKQTEGKIPELLADDSVNFQTRLVLVNALYFKGMWACQFCKESTREMPFYINKDE--- 191

  Fly   262 KIP--MMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPI 324
            |.|  ||.|...|.: :.|:.|...:|.:||...: |:::|:||::|..|:.|.|:|       .
Mouse   192 KRPVQMMCQTDTFMF-AFVDELPARLLIMPYEGME-LSLMVLLPEKGVDLSKVENDL-------T 247

  Fly   325 LQRLAAF-RNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMS--SGLFAK 386
            .::|.|: :.......||:|.:|||....|:.:|.||..:||.|:|::..|:|..||  ..|...
Mouse   248 FEKLIAWTKPDIMWSTEVKVFLPKFKLQEDYEMKSVLQCLGIVDVFEKEKADLSAMSPERNLCLS 312

  Fly   387 LVVHSTKIIVDEQGTTAGAVTEA----ALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            ..:|.:.:.|:|:||.|.|.:.|    .|.....|..|..:.||.:.|....|..:||.|:..:|
Mouse   313 KFIHKSVVEVNEEGTEAAAASSAEGIIPLCLGGGPSWFCADHPFLFFIRHNQTNSILFCGRFSSP 377

  Fly   448  447
            Mouse   378  377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 105/381 (28%)
Serpinb9bNP_035582.1 SERPIN 4..377 CDD:294093 106/387 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.