DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpina1e

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_033273.1 Gene:Serpina1e / 20704 MGIID:891967 Length:413 Species:Mus musculus


Alignment Length:415 Identity:101/415 - (24%)
Similarity:190/415 - (45%) Gaps:59/415 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QSGVSHIQSMRSNFDTDVLVSISQGVQDFALDLLQRISVEVEKAN-KDFMISPFSVWSLLVLLYE 114
            ||..||              .|:..:.|||:.|.:.:   |.::| .:...||.|:.:...:|..
Mouse    37 QSPASH--------------EIATNLGDFAISLYREL---VHQSNTSNIFFSPVSIATAFAMLSL 84

  Fly   115 GSEGETRNQLKKSLRINV---EDEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYR 176
            ||:|:|..|:.:.|:.|:   .:..:..:::.....||...|.::::      ||.|..:.|:.:
Mouse    85 GSKGDTHTQILEGLQFNLTQTSEADIHNSFQHLLQTLNRPDSELQLS------TGNGLFVNNDLK 143

  Fly   177 -------DAIQNYNVQPMEVDF-YSPDSVIQINEDTNRTTRGLIPYTI--LPQDVYGAKMFLLSS 231
                   :|..:|..:...|:| .|.::...||:...:.|:|.|...:  |.||.    :|:|::
Mouse   144 LVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIVEAVKKLEQDT----VFVLAN 204

  Fly   232 -LYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDR 295
             :.|||:||.||:...|::..|..:....: |:|||.. :....|.:...|..:||.:.|.  ..
Mouse   205 YILFKGKWKKPFDPENTKQAEFHVDESTTV-KVPMMTL-SGMLDVHHCSTLSSWVLLMDYA--GN 265

  Fly   296 LAMIVVLPKRGFKLNDVANNL-KALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGV 359
            ...:.:||..| |:..:...| |.|..:.:|.|    |.|.:     ::.:|:...:.::.|:.:
Mouse   266 ATAVFLLPDDG-KMQHLEQTLNKELISKFLLNR----RRRLA-----QIHIPRLSISGNYNLETL 320

  Fly   360 LIQMGIRDLFDE--NTANLDRMSSGLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLL 422
            :..:||..:|:.  :.:.:...::.|.....||...:.:||.||.|.|.|.......:.||....
Mouse   321 MSPLGITRIFNSGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAATVLQGGFLSMPPILHF 385

  Fly   423 NRPFQYMIVEKATGLLLFAGQVRNP 447
            ||||.::|.|:.:...||.|:|.:|
Mouse   386 NRPFLFIIFEEHSQSPLFVGKVVDP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 94/386 (24%)
Serpina1eNP_033273.1 SERPIN 53..410 CDD:214513 92/383 (24%)
RCL 368..387 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.