DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpina12

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_620180.2 Gene:Serpina12 / 191570 RGDID:708485 Length:414 Species:Rattus norvegicus


Alignment Length:442 Identity:113/442 - (25%)
Similarity:205/442 - (46%) Gaps:41/442 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLG-AIFLCSADPQNNQAPLQLSVGNPLTAFTAPTAFQSGVSHIQSMRSNFDTDVLVSISQGVQ 77
            |:|| .:||...          |:|...|....||..::|.| .:|..|...|..   .:::...
  Rat     3 LVLGLGLFLAGL----------LTVKGLLQDRDAPDTYESPV-RVQEWRGKKDAR---ELTRHNM 53

  Fly    78 DFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRI-NVEDEKLRGAY 141
            :|...||||::....:.|  ..:||.|:.:...:|..|::..|..::::.... .:.|..:...:
  Rat    54 EFGFKLLQRLASNSRQGN--IFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMSDRDMHMGF 116

  Fly   142 KVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQN-YNVQPMEVDFYSPDSVIQ-INEDT 204
            ......||..|..::::...|::..:....:..:....:| |:...:..:|...::..: ||:..
  Rat   117 HYLLQKLNRETQDVKMSIGNALFMDQRLRPQQRFLKLAKNLYDADMILTNFQDLENTQKNINKYI 181

  Fly   205 NRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQE 269
            :|.|...|...:...|. |..|.|.:.:||:|:|::.|:...|:||.||.|.|:.: |:|||.|.
  Rat   182 SRKTHNRIENMVKNIDP-GTVMLLTNYIYFQGRWQYEFDPKQTKEEDFFIEEGKTV-KVPMMFQR 244

  Fly   270 A--NFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFR 332
            .  :.||.|.   |...:||:||  :..:....|||..| ||..:...|:|       ...|.::
  Rat   245 GMYDMAYDSQ---LSCTILEMPY--RRNITATFVLPDSG-KLRLLEQGLQA-------DIFAKWK 296

  Fly   333 NRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSGLFAKL--VVHSTKII 395
            :..|: ..|:|.:|:...:..:.:|.||.::||..:|:|: .:|.|:||....|:  .||..::.
  Rat   297 SLLSK-RVVDVWVPRLHISATYNMKKVLSRLGISKIFEEH-GDLTRISSHRSLKVGEAVHKAELR 359

  Fly   396 VDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            ::|:||...|.:.|......||.:..||.||..||.|.....::|..::.||
  Rat   360 MNEKGTEGAAGSGAQTLPMETPRRMKLNAPFLMMIYENLMPSMIFLARIYNP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 96/375 (26%)
Serpina12NP_620180.2 alpha-1-antitrypsin_like 51..408 CDD:239011 96/375 (26%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.