DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and srp-2

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_503318.1 Gene:srp-2 / 178586 WormBaseID:WBGene00005643 Length:359 Species:Caenorhabditis elegans


Alignment Length:383 Identity:95/383 - (24%)
Similarity:167/383 - (43%) Gaps:54/383 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 DFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYK 142
            ||||.||..:     ..:...::||.|:...|.|::.|:.|.|:.:|          |.:.|..:
 Worm    10 DFALKLLATL-----PHSGSVVLSPLSISLGLALIHAGACGSTQKEL----------EDVLGGSR 59

  Fly   143 VWSSFLNI------TTSTIEVATLQAIYTGKGYPIKNNYRDAIQN-YNVQPMEVDFYSPDSVIQ- 199
            ::..|..:      |.:.:|...:..::..:.|.|..:|.:.::. |......:||...:...: 
 Worm    60 IFEEFSGLMEAVGDTDNGVETKIVNRVFVNQAYTIHQDYLETVEKLYKASGESLDFSQTEQAAKT 124

  Fly   200 ----INEDTNRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVI 260
                :...||...:.|||    ......|..||::::|||..|:..|.|..|....||:...| .
 Worm   125 MNTFVENHTNGKIKDLIP----ADSANNAFAFLVNAMYFKADWQSKFAKESTTGREFFTSEAE-S 184

  Fly   261 GKIPMMVQ-EANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPI 324
            .:||.:.: :.:..|..:|.   ..||.|.| ...:..:.:.|||:.|.|.|....:....::.:
 Worm   185 RQIPFLTELDEHRDYTEDVL---FQVLSLKY-ADPKFTLAIFLPKQRFGLVDALEKINGEYIQNL 245

  Fly   325 LQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSGLFAKLVV 389
            |..|        :.:.|.|.:|||....:..||..|..:||:::|.|. |:|..::..:|....:
 Worm   246 LNDL--------KSSYVSVQIPKFKIEKELDLKETLEAIGIKEIFAEG-ADLSGIADKVFISSGI 301

  Fly   390 HSTKIIVDEQGTTAGAVT----EAALANKATPPKFLLNRPFQYMIV-EKATGLLLFAG 442
            |...|.|||.||||.|.:    :..:...|.|.:|:.:.||.:.:: |..|   ||.|
 Worm   302 HKAIIEVDEDGTTAAAASAFKVQLEMMIMAEPTQFVADHPFLFAVLFENHT---LFLG 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 95/383 (25%)
srp-2NP_503318.1 serpinL_nematode 7..358 CDD:381047 95/383 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.