DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpini2

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001127881.1 Gene:Serpini2 / 171149 RGDID:619897 Length:405 Species:Rattus norvegicus


Alignment Length:393 Identity:100/393 - (25%)
Similarity:180/393 - (45%) Gaps:37/393 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SISQGVQDFALDLLQRISVEVEKANKDFMI-SPFSVWSLLVLLYEGSEGETRNQLKKSLRINVED 134
            ::.|...:||:||.:.||:    :||:.:| ||.....||.::..|::|:.:.|:.::||  ::.
  Rat    21 TMDQKNAEFAVDLYKAISL----SNKNNVIFSPLGTTVLLGMVQLGAKGKAQQQIMQTLR--MQK 79

  Fly   135 EKLRGAYKVWSSFLNITTS-----TIEVATLQAIYTGKGYPIKNNYRDAIQNYNVQPME-VDFYS 193
            ......:.|..|..:..:.     |..:|:  |:|..:|:.:|.:|..:.:.:.....: |||..
  Rat    80 TSTGEEFSVLKSLFSAISKKKQEFTFNLAS--ALYLQEGFIVKESYLHSNKEFFQSATKLVDFLD 142

  Fly   194 PDSVIQ-INEDTNRTTRGLIPYTILPQDVYG--AKMFLLSSLYFKGQWKFPFNKTLTREEPFFSE 255
            ..:..| |:......|.|.|......:| :|  .::.|::::||||.||..|.|..|....|..:
  Rat   143 AKTSAQAISTWVESKTDGKIKNMFSEED-FGPLTRLVLVNAIYFKGDWKQKFRKEDTEMTDFSKK 206

  Fly   256 SGEVIGKIPMM--VQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKA 318
            .|..: |||||  :..|.:.|.|. ..:...|||||| ..|..:::::||.....:.:|...:.|
  Rat   207 DGSTV-KIPMMKALLRAKYGYFSE-SSMTYQVLELPY-KADEFSLVILLPTEDVNIEEVEKQVTA 268

  Fly   319 LGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRM--SS 381
            ..::.....|        .:.||||.:|:|........|..|..:.:.::| ....:|..:  ||
  Rat   269 RHVQKWFSEL--------HEEEVEVSLPRFKIEQKLDFKEALFSLNVTEIF-SGGCDLSGITDSS 324

  Fly   382 GLFAKLVVHSTKIIVDEQGTTAGAVT--EAALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQV 444
            .|:....:......::|.|:.|.|.|  ........|..:||.|.||.:::....|..:||.|:|
  Rat   325 ELYVSRAMQKVFFEINEDGSEAAASTGINIPAIMSLTQTQFLANHPFLFIMKHIQTESILFMGKV 389

  Fly   445 RNP 447
            .:|
  Rat   390 TDP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 97/384 (25%)
Serpini2NP_001127881.1 SERPIN 23..405 CDD:294093 100/391 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.