DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPINA12

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:449 Identity:101/449 - (22%)
Similarity:197/449 - (43%) Gaps:54/449 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PLLLGAIFLCSADPQNNQAPLQLSVGNPLTAFTAPTAFQSGVSHIQSMRSNFDTDVLVSISQGVQ 77
            |.|..||||.          :.|:|...|....:|..::: :|.:|..:...   ....:::...
Human     3 PTLGLAIFLA----------VLLTVKGLLKPSFSPRNYKA-LSEVQGWKQRM---AAKELARQNM 53

  Fly    78 DFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEK-LRGAY 141
            |....||::::  .....::..:||.|:.:...:|..|::..|.:::|:........|| |...:
Human    54 DLGFKLLKKLA--FYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGF 116

  Fly   142 KVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQNYNVQPMEVDFYSPDSVI-------- 198
            ......|...|..::::....::..:....:..:.:..:|         |||.::::        
Human   117 HYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKN---------FYSAETILTNFQNLEM 172

  Fly   199 ---QINEDTNRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVI 260
               |||:..::.|.|.|...|...|. |..|.|.:.::|:.:||..|:..:|:||.||.|....:
Human   173 AQKQINDFISQKTHGKINNLIENIDP-GTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSV 236

  Fly   261 GKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPIL 325
             |:|||.:...: .|...:.|...:||:||  |..:..|.:||..| ||..:...|:       :
Human   237 -KVPMMFRSGIY-QVGYDDKLSCTILEIPY--QKNITAIFILPDEG-KLKHLEKGLQ-------V 289

  Fly   326 QRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSGLFAKL--V 388
            ...:.::...|. ..|:|.:|:......|.||..|..:|:..:|:|: .:|.:::.....|:  .
Human   290 DTFSRWKTLLSR-RVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEH-GDLTKIAPHRSLKVGEA 352

  Fly   389 VHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            ||..::.:||:||...|.|.|......||....:::|:..:|..:....:||.|::.||
Human   353 VHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 87/382 (23%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 87/399 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.