DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpina6

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus


Alignment Length:404 Identity:96/404 - (23%)
Similarity:173/404 - (42%) Gaps:81/404 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 DFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRIN---VEDEKLRG 139
            |||.:|.:|:  ....::|:.:|||.|:...|.:|...:.|.|  |..::|..|   :.:.::..
Mouse    40 DFAFNLYKRL--VALNSDKNTLISPVSISMALAMLSLSTRGST--QYLENLGFNMSKMSEAEIHQ 100

  Fly   140 AYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQNYNVQPMEVDFYSPDSVI------ 198
            .::..:|.|..:.:.:|:.....::..:...:|:::....::|         |..:::.      
Mouse   101 GFQYLNSLLQQSDTGLEMNMGNVMFLLQNLKLKDSFLADTKHY---------YESEALTIPSKDW 156

  Fly   199 -----QINEDTNRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFF-SESG 257
                 |||......|:|.|.:.:...| ..|.:.|::.::.||.||.||:...||||.|: :|:.
Mouse   157 TKAGEQINNHVKNKTQGKIEHVVSDLD-SSATLILINYIFLKGIWKLPFSPENTREEDFYVNETS 220

  Fly   258 EVIGKIPMMVQEANFAYVSNVEGLDGYVLELPY---GTQDRLAMIVVLPKRGFKLNDVANNLKAL 319
            .|  |:|||||..|.:|..: ..:...::::.|   ||     ..::||.:|             
Mouse   221 TV--KVPMMVQSGNISYFRD-SAIPCQMVQMNYVGNGT-----TFIILPDQG------------- 264

  Fly   320 GLRPILQRLAAFRNRASED--------NEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANL 376
                .:..:.|..||.:.|        .::.:.:|||..:..:.|:.||..:||:|||...:...
Mouse   265 ----QMDTVVAALNRDTIDRWGKLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQSDFA 325

  Fly   377 DRMSSGLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFL--------LNRPFQYMIVEK 433
            |..........|:|...:.:|| |....|.|..       ||..|        .||||.::..:|
Mouse   326 DTTKDTPLTLTVLHKAMLQLDE-GNVLPAATNG-------PPVHLPSESFTLKYNRPFIFLAFDK 382

  Fly   434 ATGLLLFAGQVRNP 447
            .|...|...||.||
Mouse   383 YTWSSLMMSQVMNP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 92/399 (23%)
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 91/399 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.