DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPINA3

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001076.2 Gene:SERPINA3 / 12 HGNCID:16 Length:423 Species:Homo sapiens


Alignment Length:404 Identity:109/404 - (26%)
Similarity:194/404 - (48%) Gaps:42/404 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 TDVLVSISQGVQDFALDLLQRISVEVEKA-NKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLR 129
            |.|.:.::....|||..|.:::   |.|| :|:.:.||.|:.:.|..|..|:...|..::.|.|:
Human    43 THVDLGLASANVDFAFSLYKQL---VLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLK 104

  Fly   130 INV---EDEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNY-RDAIQNYNVQPMEVD 190
            .|:   .:.::..:::.....||.::..::::...|::..:...:.:.: .||.:.|..:....|
Human   105 FNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATD 169

  Fly   191 FYSPDSVIQ---INEDTNRTTRGLIPYTILPQDVYG-AKMFLLSSLYFKGQWKFPFNKTLTREEP 251
            |  .||...   ||:.....|||.|  |.|.:|:.. ..|.|::.::||.:|:.||:...|.:..
Human   170 F--QDSAAAKKLINDYVKNGTRGKI--TDLIKDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSR 230

  Fly   252 FFSESGEVIGKIPMM-VQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANN 315
            |:....:.: .:||| :......|..: |.|...|:||.|  ....:.:.:||.:     |....
Human   231 FYLSKKKWV-MVPMMSLHHLTIPYFRD-EELSCTVVELKY--TGNASALFILPDQ-----DKMEE 286

  Fly   316 LKALGLRPILQRLAAFRNRASEDNEV-EVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRM 379
            ::|:.|...|:|   :|: :.|..|: |:.:|||..:.|:.|..:|:|:||.:.| .:.|:|..:
Human   287 VEAMLLPETLKR---WRD-SLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAF-TSKADLSGI 346

  Fly   380 SS--GLFAKLVVHSTKIIVDEQGTTAGAVTE------AALANKATPPKFLLNRPFQYMIVEKATG 436
            :.  .|....|||...:.|.|:||.|.|.|.      :||....|..:|  ||||..:||...|.
Human   347 TGARNLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSALVETRTIVRF--NRPFLMIIVPTDTQ 409

  Fly   437 LLLFAGQVRNPKAA 450
            .:.|..:|.|||.|
Human   410 NIFFMSKVTNPKQA 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 102/387 (26%)
SERPINA3NP_001076.2 serpinA3_A1AC 40..421 CDD:381019 106/400 (27%)
RCL 369..394 8/24 (33%)
O-glycosylated at one site 381..389 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.