DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and serpine1

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001108031.1 Gene:serpine1 / 100136840 ZFINID:ZDB-GENE-070912-60 Length:384 Species:Danio rerio


Alignment Length:382 Identity:104/382 - (27%)
Similarity:192/382 - (50%) Gaps:23/382 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SISQGVQDFALDL-LQRISVEVEKA-NKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVE 133
            |:...:||...|. ||..:..|:.| :::..:||:.:.|:|.:...|:.|.|...|...:..:::
Zfish    16 SLCNLIQDKQTDFGLQVFAEAVQSAPDRNLALSPYGIASVLGMAQMGAYGATLKLLASKMGYSLQ 80

  Fly   134 DEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQN-YNVQPMEVDFYSPDSV 197
            :   ||..|:.........|...|.....:...:...::..:|.::.. :...|.::||..|:..
Zfish    81 E---RGMPKLQRLLQRDLASEDGVEVASGVMVDRKIILEKVFRRSLSKAFQSVPHQIDFSQPEMA 142

  Fly   198 IQ-INEDTNRTTRGLIPYTILPQDVYG--AKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEV 259
            .| ||..|:..|.|:|. ..||..|..  .::..|::|:|.|.||.||:...|||:.|.:.:|..
Zfish   143 RQVINSWTSDHTDGMIS-EFLPSGVLSELTRLVFLNALHFHGVWKTPFDPRNTREQLFHTVNGSA 206

  Fly   260 IGKIPMM--VQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLR 322
            : .:|||  .|:.|:....:.:|:|..|:|:|| ..:.::|::|.|   |: .||.  |.||...
Zfish   207 V-SVPMMTTTQKFNYGEFVSKDGVDYDVIEMPY-EGESISMLLVTP---FE-KDVP--LSALNKE 263

  Fly   323 PILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSS--GLFA 385
            ....|:..:|....:.:: ::.:|:|...|:..||..|.:||:.|:|.::.|:..|:::  .|..
Zfish   264 LSSSRIHQWRQEMRKISK-QLSIPRFSMDTEIDLKSTLSRMGLGDIFSQSRADFSRITTEEPLCV 327

  Fly   386 KLVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATGLLLFAG 442
            ..|:...|:.|:|:||...:.|.|.:.::....:..|:|||.::|..|.||.|||:|
Zfish   328 SKVLQRVKLEVNEEGTKGSSATAAVIYSRMAVEEITLDRPFFFLIQHKPTGALLFSG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 103/378 (27%)
serpine1NP_001108031.1 SERPIN 26..384 CDD:294093 100/370 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.