DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and serpina10b

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_009291625.1 Gene:serpina10b / 100003661 ZFINID:ZDB-GENE-100716-5 Length:395 Species:Danio rerio


Alignment Length:450 Identity:111/450 - (24%)
Similarity:210/450 - (46%) Gaps:81/450 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLGAIFLCSADPQNNQAPLQLSVGNPLTAFTAPTAFQSGVSHIQSMRSNFDTDVLVSISQGVQD 78
            :.:.|.|||||:.:..:.|           ..:..||::                        .|
Zfish     8 VFISACFLCSAEHEELRTP-----------DISDLAFRN------------------------TD 37

  Fly    79 FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRG--AY 141
            ||::|.::||   ...:::.:.||.||.:....|...::|.||.::.|.|.:    |.|.|  :.
Zfish    38 FAINLYRKIS---SLHDRNVVFSPLSVSTCFSALLLAAQGSTRTEILKGLNL----EALDGGDSR 95

  Fly   142 KVWSSFLNITTS-TIEVATLQAIYTGKGYPIKNNYRDAIQN-YNVQPMEVDFYSPDSVIQ--INE 202
            :|...|..:..: ::::....|::..:.:.::.|:...||. :|.:.:.|||..| :|.:  |||
Zfish    96 RVPELFQQLHQNISLQMEQGTALFLDQHFHLQTNFSQQIQRFFNAEVLRVDFSKP-AVCRSLINE 159

  Fly   203 DTNRTT--------RGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEV 259
            ..:|.|        ..:.|.|         :|.||:::::||.|:.|||...|.:..|:.:...:
Zfish   160 FVSRKTGRKVLEMLESVEPLT---------QMLLLNTIFYKGDWERPFNPNNTEKSRFYVDKYNI 215

  Fly   260 IGKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPI 324
            : ::|||:.|..|:.|.: ..|...||.|||  :...:|:::||........:.:.:.|..|...
Zfish   216 V-QVPMMMLEEKFSVVED-RDLRARVLRLPY--RGGASMLILLPSADADYTAIEDEISAERLHGW 276

  Fly   325 LQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSGLFAKL-- 387
            ::.:...:        :||.:|:|.....:.:..:|.|:||..:| :::|:|..:|.....|:  
Zfish   277 IKNMRRMK--------MEVHLPRFRMDQSYHMHELLPQLGISSVF-QDSADLTGLSRDAHLKVSQ 332

  Fly   388 VVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            |:|...|.|.||||:|.:.|...:...:.|..|::||||.:.:..:.|..|||.|:|.:|
Zfish   333 VLHKAVIEVYEQGTSAASSTSVGITAYSLPDTFIINRPFFFFLYHEETASLLFMGRVIDP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 100/384 (26%)
serpina10bXP_009291625.1 Serpin 35..392 CDD:278507 101/410 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.