DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaSnap and napb

DIOPT Version :9

Sequence 1:NP_524180.1 Gene:alphaSnap / 40233 FlyBaseID:FBgn0250791 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001072566.1 Gene:napb / 780021 XenbaseID:XB-GENE-954550 Length:296 Species:Xenopus tropicalis


Alignment Length:295 Identity:186/295 - (63%)
Similarity:233/295 - (78%) Gaps:5/295 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DN---EQKALQLMAEAEKKLTQQKGFLGSLFGGSNKVEDAIECYQRAGNMFKMSKNWTKAGECFC 64
            ||   |::|:||||||||::...:.||..||||:.|||:|.|.|.||.|||||:|||:.||..||
 Frog     2 DNSGKEREAVQLMAEAEKRVKSSQSFLRGLFGGNTKVEEACEMYARAANMFKMAKNWSAAGNAFC 66

  Fly    65 EAATLHARAGSRHDAGTCYVDASNCYKKVDVESAVNCLMKSIDIYTDMGRFTMAAKHHQSIAEMY 129
            :||.||.:..|:|||.|.:|||.|.|||.|.:.|:|||..:|||||||||||:|||||.:|||:|
 Frog    67 QAAKLHMQLQSKHDAATSFVDAGNAYKKADPQEAINCLNAAIDIYTDMGRFTIAAKHHITIAEIY 131

  Fly   130 ESDPNNLAKSIQHYEQAADYFKGEESVSSANKCMLKVAQYAAQLEDYEKAISIYEQVAASSLESS 194
            |::..::.|:|.||||:|||:|||||.||||||:||||.||||||.|:|||.||||:..|::::.
 Frog   132 ETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAAYAAQLEQYQKAIEIYEQIGTSTMDNP 196

  Fly   195 LLKYSAKEYFFRAALCHLSVDLLNAQHAIEKYAQQYPAFQDSREFKLIKVLCENLEEQNIEGFTE 259
            |||||||||||:|||||..||.|||:.|:|||.:.:|||.||||.||:|.|.|..||||.:.:||
 Frog   197 LLKYSAKEYFFKAALCHFIVDELNAKLALEKYEEMFPAFTDSRECKLLKKLLEAHEEQNSDAYTE 261

  Fly   260 AVKDYDSISRLDQWYTTILLRIKKA--ADEDPDLR 292
            |||::|||||||||.||:||||||:  .|.|.||:
 Frog   262 AVKEFDSISRLDQWLTTMLLRIKKSIQGDGDGDLK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaSnapNP_524180.1 SNAP 7..284 CDD:276937 178/276 (64%)
SNAP 7..284 CDD:291599 178/276 (64%)
TPR repeat 35..72 CDD:276937 24/36 (67%)
TPR repeat 76..112 CDD:276937 21/35 (60%)
TPR repeat 115..152 CDD:276937 21/36 (58%)
TPR repeat 156..192 CDD:276937 25/35 (71%)
napbNP_001072566.1 SNAP 9..288 CDD:373405 179/278 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 373 1.000 Domainoid score I879
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 379 1.000 Inparanoid score I2020
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191204at2759
OrthoFinder 1 1.000 - - FOG0001605
OrthoInspector 1 1.000 - - otm49513
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1307
SonicParanoid 1 1.000 - - X1012
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.