DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaSnap and gammaSnap1

DIOPT Version :9

Sequence 1:NP_524180.1 Gene:alphaSnap / 40233 FlyBaseID:FBgn0250791 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_477469.1 Gene:gammaSnap1 / 37842 FlyBaseID:FBgn0028552 Length:302 Species:Drosophila melanogaster


Alignment Length:305 Identity:68/305 - (22%)
Similarity:121/305 - (39%) Gaps:48/305 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALQLMAEAEKKLTQ-QKGFLGSLFGGSNKVEDAIECYQRAGNMFKMSKNWTKAGECFCEAATLHA 71
            |.:.:||||..:.| :|....|:.......:.|.:.|.:|...::::|::.|:.|||.:|...:.
  Fly     5 AAKKIAEAEDLVKQAEKSLKLSMLKWVPDYDSAADEYSKAATAYRIAKSYDKSKECFLKAIDAYK 69

  Fly    72 RAGSRHDAGTCYVD----ASNCYKKVDVESAVNCLMKSIDIYTDMGRFTMAAKHHQSIAEMYESD 132
            ...|...|...|..    :.:..|..:||...|   ||..:|...|....||......|::.||.
  Fly    70 NNKSWFHAAKAYEQIILLSKDADKLHEVEEYAN---KSASLYQQHGSPEAAASALDKAAKLTESK 131

  Fly   133 PNNLAKSIQHYEQAADYFKGEESVSSANKCMLKVAQYAAQLEDYEKAISIYEQVAASSLESSL-L 196
            ..::|  ::.|:.|.:....|:||..|.:...||::...:|..|::        |.::|:..: |
  Fly   132 HPDMA--LRFYQHALEVIMIEDSVRQAAEYASKVSRILVKLRRYDE--------ATNALKKEISL 186

  Fly   197 KYSAKEYFFRAALCHLSVDLLNAQHAIEKYAQQYPAFQDSREFKLIKVLCENLEEQNIEGFTEAV 261
            ....:.|   ..:..|.|.|:..|.|      :..:.:..:.|:.....||..|...::...:|.
  Fly   187 NQQTESY---GQIGRLVVALVMVQLA------RGDSVEAEKTFREWGNCCEPEEVSTLQTLLQAF 242

  Fly   262 KDYDS-----------ISRLDQWYTTILLRI---------KKAAD 286
            .|.|.           |..:|..|..:...|         |||.|
  Fly   243 DDEDPELAARMLASPFIRHMDVEYAILSKNIPLPQGIQMEKKAGD 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaSnapNP_524180.1 SNAP 7..284 CDD:276937 65/301 (22%)
SNAP 7..284 CDD:291599 65/301 (22%)
TPR repeat 35..72 CDD:276937 9/36 (25%)
TPR repeat 76..112 CDD:276937 9/39 (23%)
TPR repeat 115..152 CDD:276937 8/36 (22%)
TPR repeat 156..192 CDD:276937 7/35 (20%)
gammaSnap1NP_477469.1 SNAP 11..248 CDD:305195 58/258 (22%)
TPR repeat 33..70 CDD:276937 9/36 (25%)
TPR repeat 74..111 CDD:276937 9/39 (23%)
TPR repeat 114..149 CDD:276937 8/36 (22%)
TPR repeat 153..187 CDD:276937 8/41 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469450
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13768
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.