DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO4 and AT1G15860

DIOPT Version :10

Sequence 1:NP_649204.2 Gene:SCCRO4 / 40231 FlyBaseID:FBgn0036967 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001185006.1 Gene:AT1G15860 / 838156 AraportID:AT1G15860 Length:236 Species:Arabidopsis thaliana


Alignment Length:237 Identity:43/237 - (18%)
Similarity:69/237 - (29%) Gaps:105/237 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 PRYYSYA--SGLLYF-----PNIRISNHNDD----------VVRVIC----------NPSTRQYA 140
            |.::||.  ||.:.|     .|.::...:.|          :.|.||          ||:.:.|.
plant    50 PLFFSYVHFSGCMAFFLSWLANFKLILFSFDQGPLSPLPRTLSRFICITCFPIKPQQNPNIQNYK 114

  Fly   141 I------------------------LPPDLRTRYRDSGRLFRNKLGV-INLEDDYDGGYLLKLRM 180
            |                        |.|.|        .|..|.|.: :.||..:   .|:|..:
plant   115 IPIWLFAIKVVIFVVLLQMYEYKQYLSPAL--------LLVFNSLHIFLELEIVF---MLVKALV 168

  Fly   181 FV------------------LEDFEKQKW----------TTYVHTLRDENKIKDNDNVYVVGATA 217
            |:                  |:||..::|          ..|:...|...:..::|....:|..|
plant   169 FITLGCDLEPQSNEPYLATSLQDFWGRRWNLMVPAILRPAVYLPARRMACRKVNSDQAMFLGVFA 233

  Fly   218 SGQIVLARNKAYKPFYVFYFNPEKSTLQSVEIQGVREEEDWF 259
            :..:    :.|......||...|..|          .|..||
plant   234 AFLV----SGAVHEMLFFYLTREVPT----------GEVTWF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCCRO4NP_649204.2 Cullin_binding 123..233 CDD:460971 29/182 (16%)
AT1G15860NP_001185006.1 Cullin_binding 107..230 CDD:460971 22/133 (17%)

Return to query results.
Submit another query.