DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO4 and DCUN1D1

DIOPT Version :10

Sequence 1:NP_649204.2 Gene:SCCRO4 / 40231 FlyBaseID:FBgn0036967 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_024309369.2 Gene:DCUN1D1 / 54165 HGNCID:18184 Length:396 Species:Homo sapiens


Alignment Length:135 Identity:34/135 - (25%)
Similarity:43/135 - (31%) Gaps:40/135 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EILSRLSVKPITRFRCV-SKLWESIICRQDFTELFHNRSSSNPRLLIGV--IQGGEWNFFSSPQP 78
            ::|.....:|...|.|| ....|:.:...||.|............|..|  ||     ..|:.|.
Human    24 KLLGAPKAQPSRDFTCVHDGESEAELIPDDFEEKPEREKKHTNFTLCNVCNIQ-----LNSAAQA 83

  Fly    79 QNHY-GKSSLVVAADSHMKFSEDKRPRYYSYASGLLYFPNIRISNHNDDVVRVICNPSTRQYAIL 142
            |.|| ||        ||.|       |....::|.|         .||       |..|.|...|
Human    84 QIHYNGK--------SHQK-------RLKQLSNGTL---------KND-------NGGTCQSPAL 117

  Fly   143 PPDLR 147
            |..:|
Human   118 PALVR 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCCRO4NP_649204.2 Cullin_binding 123..233 CDD:460971 8/25 (32%)
DCUN1D1XP_024309369.2 UBA_DCNL1 139..188 CDD:270594
Cullin_binding 273..383 CDD:460971
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.