DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Pex23 and Lgals3

DIOPT Version :9

Sequence 1:	NP_730508.1	Gene:	Pex23 / 40229	FlyBaseID:	FBgn0052226	Length:	1350	Species:	Drosophila melanogaster
Sequence 2:	NP_114020.1	Gene:	Lgals3 / 83781	RGDID:	69356	Length:	262	Species:	Rattus norvegicus

Alignment Length:	139	Identity:	38/139 - (27%)
Similarity:	61/139 - (43%)	Gaps:	17/139 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   815 PYYNTLYNGMPCGTELEISGCVYDDADQIRFDLQSHSAVKVQPHRVEKHRVIALHLNPRFNE--- 876
            ||...|..|:.....:.|.|.|..:|:.|..:.             :|...||.|.||||||
  Rat   129 PYDMPLPGGVMPRMLITIIGTVKPNANSITLNF-------------KKGNDIAFHFNPRFNENNR 180

  Fly   877 RTTVLNSMKESEWLDEIRNDKMAFAPGATFSLKIRALQDHYLIIVNNAVYTDYKYRI-DPESVTR 940
            |..|.|:.:::.|..|.|.....|..|..|.:::....||:.:.||:.....|.:|: :...:::
  Rat   181 RVIVCNTKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQ 245

  Fly   941 LYVSGRIKL 949
            |.:.|.|.|
  Rat   246 LGIIGDITL 254

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Pex23	NP_730508.1	DysFN	64..125	CDD:214777
		Hyd_WA	210..238	CDD:283993
		Hyd_WA	257..282	CDD:283993
		TECPR	280..320	CDD:214782
		TECPR	338..371	CDD:214782
		PH-like	639..759	CDD:302622
		Gal-bind_lectin	815..954	CDD:278752	38/139 (27%)
		TECPR	966..1000	CDD:214782
		DysFN	1021..1081	CDD:214777
		DysFC	1092..>1113	CDD:128935
		Hyd_WA	1165..1192	CDD:283993
		Hyd_WA	1209..1237	CDD:283993
		Hyd_WA	1308..1333	CDD:283993
Lgals3	NP_114020.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..102
		Bindin	18..>116	CDD:251078
		9 X 9 AA tandem repeats of Y-P-G-X(3)-P-[GS]-[AG]	35..112
		GLECT	129..256	CDD:238025	38/139 (27%)
		Beta-galactoside binding. /evidence=ECO:0000250	193..199		2/5 (40%)
		Nuclear export signal. /evidence=ECO:0000250	238..253		2/14 (14%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3587
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810