DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex23 and grifin

DIOPT Version :10

Sequence 1:NP_730508.1 Gene:Pex23 / 40229 FlyBaseID:FBgn0288469 Length:1350 Species:Drosophila melanogaster
Sequence 2:NP_001003430.1 Gene:grifin / 445036 ZFINID:ZDB-GENE-040801-163 Length:139 Species:Danio rerio


Alignment Length:85 Identity:25/85 - (29%)
Similarity:44/85 - (51%) Gaps:1/85 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   866 IALHLNPRFNERTTVLNSMKESEWLDEIRNDKMAFAPGATFSLKIRALQDHYLIIVNNAVYTDYK 930
            :|.|.||||.|...:.||...:.|..|.|.:.........|.::|.:..||:.:.::.|....||
Zfish    44 VAFHFNPRFTESDIICNSYMANRWGQEERCNHFPLGVEEPFQIEIYSDNDHFHVYIDKAKVMQYK 108

  Fly   931 YRI-DPESVTRLYVSGRIKL 949
            :|: |.:::|:|.|...:|:
Zfish   109 HRVEDLKTITKLQVVNDVKI 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex23NP_730508.1 DysFN 64..125 CDD:214777
Tectonin 210..398 CDD:465992
PH-like 639..759 CDD:473070
Gal-bind_lectin 821..953 CDD:459768 25/85 (29%)
TECPR 966..1000 CDD:214782
DysFN 1021..1081 CDD:214777
DysFC 1092..>1113 CDD:128935
Tectonin <1165..1333 CDD:465992
grifinNP_001003430.1 Gal-bind_lectin 10..132 CDD:214904 25/85 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.