DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex23 and GRIFIN

DIOPT Version :10

Sequence 1:NP_730508.1 Gene:Pex23 / 40229 FlyBaseID:FBgn0288469 Length:1350 Species:Drosophila melanogaster
Sequence 2:NP_001381716.1 Gene:GRIFIN / 402635 HGNCID:4577 Length:144 Species:Homo sapiens


Alignment Length:99 Identity:24/99 - (24%)
Similarity:43/99 - (43%) Gaps:20/99 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   823 GMPCGTELEISGCVYDDADQIRFD----LQSHSAVKVQPHRVEKHRVIALHLNPRFNERTTVLNS 883
            |:..|.:|.:.|  :.|:.:.||:    |::..              ||.|:.|||:..|.|.|:
Human    12 GLAPGWKLLVQG--HADSGEDRFETNFLLETGD--------------IAFHIKPRFSSATVVGNA 60

  Fly   884 MKESEWLDEIRNDKMAFAPGATFSLKIRALQDHY 917
            .:...|..|..:.....|||..|.:::....:|:
Human    61 FQYGRWGPEQVSSIFPLAPGEPFEIEVSWDAEHF 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex23NP_730508.1 DysFN 64..125 CDD:214777
Tectonin 210..398 CDD:465992
PH-like 639..759 CDD:473070
Gal-bind_lectin 821..953 CDD:459768 24/99 (24%)
TECPR 966..1000 CDD:214782
DysFN 1021..1081 CDD:214777
DysFC 1092..>1113 CDD:128935
Tectonin <1165..1333 CDD:465992
GRIFINNP_001381716.1 Gal-bind_lectin 11..131 CDD:214904 24/99 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.