DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Pex23 and lgals2b

DIOPT Version :9

Sequence 1:	NP_730508.1	Gene:	Pex23 / 40229	FlyBaseID:	FBgn0052226	Length:	1350	Species:	Drosophila melanogaster
Sequence 2:	XP_005172121.1	Gene:	lgals2b / 393486	ZFINID:	ZDB-GENE-040426-1590	Length:	132	Species:	Danio rerio

Alignment Length:	129	Identity:	33/129 - (25%)
Similarity:	54/129 - (41%)	Gaps:	15/129 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   827 GTELEISGCVYDDADQIRFDLQSHSAVKVQPHRVEKHRVIALHLNPRFN---ERTTVLNSMKESE 888
            |.|::|||.|....|....:: .|.           ...||||.|||||   :..|::.:.|:..
Zfish    13 GMEMKISGKVKPGCDAFSINI-GHD-----------DDAIALHFNPRFNAHGDSNTIVCNSKQGG 65

  Fly   889 WLDEIRNDKMAFAPGATFSLKIRALQDHYLIIVNNAVYTDYKYRIDPESVTRLYVSGRIKLFNV 952
            |..|.|.....|..|..|.|.|....:.:.|.:.......:..|...::.:.::|.|.:|:.:|
Zfish    66 WGSEHREHCFPFQQGEEFKLSITFNNETFYIKLPEGTMMSFPNRFGDDAFSHVHVKGDVKIISV 129

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Pex23	NP_730508.1	DysFN	64..125	CDD:214777
		Hyd_WA	210..238	CDD:283993
		Hyd_WA	257..282	CDD:283993
		TECPR	280..320	CDD:214782
		TECPR	338..371	CDD:214782
		PH-like	639..759	CDD:302622
		Gal-bind_lectin	815..954	CDD:278752	33/129 (26%)
		TECPR	966..1000	CDD:214782
		DysFN	1021..1081	CDD:214777
		DysFC	1092..>1113	CDD:128935
		Hyd_WA	1165..1192	CDD:283993
		Hyd_WA	1209..1237	CDD:283993
		Hyd_WA	1308..1333	CDD:283993
lgals2b	XP_005172121.1	GLECT	9..130	CDD:238025	33/129 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910