DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex23 and C53D6.10

DIOPT Version :9

Sequence 1:NP_730508.1 Gene:Pex23 / 40229 FlyBaseID:FBgn0052226 Length:1350 Species:Drosophila melanogaster
Sequence 2:NP_001023094.1 Gene:C53D6.10 / 3565065 WormBaseID:WBGene00023424 Length:175 Species:Caenorhabditis elegans


Alignment Length:105 Identity:21/105 - (20%)
Similarity:28/105 - (26%) Gaps:49/105 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 SGVTSADPTGKKWRLIQCPMQISRTSSSLSIVSRKSGGSSSTPGSKHQSFSNLYSKEKEKGVVET 434
            |.:..|...|||                     :|:|.||.|      ...|...|.|.|...: 
 Worm    77 SKIVKATGDGKK---------------------KKNGKSSET------KTKNKVKKNKSKASAD- 113

  Fly   435 CAVIETVLNSSTGSCSSNGGPPGLLKNERWKLSADSPPTI 474
                    .|..||...             :||.:.|.|:
 Worm   114 --------ESQMGSAEE-------------RLSTNRPSTL 132

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Pex23NP_730508.1 DysFN 64..125 CDD:214777
Hyd_WA 210..238 CDD:283993
Hyd_WA 257..282 CDD:283993
TECPR 280..320 CDD:214782