Sequence 1: | NP_730508.1 | Gene: | Pex23 / 40229 | FlyBaseID: | FBgn0052226 | Length: | 1350 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001334728.1 | Gene: | CG13950 / 33267 | FlyBaseID: | FBgn0031289 | Length: | 316 | Species: | Drosophila melanogaster |
Alignment Length: | 208 | Identity: | 41/208 - (19%) |
---|---|---|---|
Similarity: | 77/208 - (37%) | Gaps: | 52/208 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 824 MPCGTELEISGCVYDDADQIRFDLQSHSAVKVQPHRVEKHRVIALHLNPRFNERTTVLNSMKE-- 886
Fly 887 SEW-LDEIRND------KMAFAPGATFSLKIRALQDHYLIIVNNAVYTDYKYRIDPESVTRLYVS 944
Fly 945 GRIK---------LFNVLY----RCPSLIVSMERMHWRQMGGHIKRIFNSGVDVVWG-------- 988
Fly 989 ------ISCDNTG 995 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pex23 | NP_730508.1 | DysFN | 64..125 | CDD:214777 | |
Hyd_WA | 210..238 | CDD:283993 | |||
Hyd_WA | 257..282 | CDD:283993 | |||
TECPR | 280..320 | CDD:214782 | |||
TECPR | 338..371 | CDD:214782 | |||
PH-like | 639..759 | CDD:302622 | |||
Gal-bind_lectin | 815..954 | CDD:278752 | 33/147 (22%) | ||
TECPR | 966..1000 | CDD:214782 | 6/44 (14%) | ||
DysFN | 1021..1081 | CDD:214777 | |||
DysFC | 1092..>1113 | CDD:128935 | |||
Hyd_WA | 1165..1192 | CDD:283993 | |||
Hyd_WA | 1209..1237 | CDD:283993 | |||
Hyd_WA | 1308..1333 | CDD:283993 | |||
CG13950 | NP_001334728.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3587 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |