DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex23 and F49F1.9

DIOPT Version :10

Sequence 1:NP_730508.1 Gene:Pex23 / 40229 FlyBaseID:FBgn0288469 Length:1350 Species:Drosophila melanogaster
Sequence 2:NP_500490.1 Gene:F49F1.9 / 186065 WormBaseID:WBGene00018649 Length:210 Species:Caenorhabditis elegans


Alignment Length:92 Identity:24/92 - (26%)
Similarity:35/92 - (38%) Gaps:25/92 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   881 LNSMKESEWL------DEIR--------NDKM---------AFAPGATFSLKIRALQDHYLIIVN 922
            :|..:|.|||      .::|        |.|.         .|..||.|::.:.....|..|.||
 Worm   110 INLDREKEWLFHFASQPDLRRVVRTRHLNGKFLLGDTYGGNPFPAGANFNVTMINQPTHIEIYVN 174

  Fly   923 NAVYTDYKYRIDPESVTRLYV--SGRI 947
            ...:|:|.:|....|....||  ||.:
 Worm   175 QVFFTNYNHRTPNPSRNYQYVVFSGNV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex23NP_730508.1 DysFN 64..125 CDD:214777
Tectonin 210..398 CDD:465992
PH-like 639..759 CDD:473070
Gal-bind_lectin 821..953 CDD:459768 24/92 (26%)
TECPR 966..1000 CDD:214782
DysFN 1021..1081 CDD:214777
DysFC 1092..>1113 CDD:128935
Tectonin <1165..1333 CDD:465992
F49F1.9NP_500490.1 GLECT 82..209 CDD:214596 24/92 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.