| Sequence 1: | NP_730508.1 | Gene: | Pex23 / 40229 | FlyBaseID: | FBgn0052226 | Length: | 1350 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_509649.1 | Gene: | lec-8 / 181198 | WormBaseID: | WBGene00002271 | Length: | 180 | Species: | Caenorhabditis elegans |
| Alignment Length: | 206 | Identity: | 50/206 - (24%) |
|---|---|---|---|
| Similarity: | 73/206 - (35%) | Gaps: | 55/206 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 840 ADQIRFDLQSHSAVKVQPHRVEKHRV-----------IALHLNPRF-NERTTVLNSMKESEWLDE 892
Fly 893 IRNDKMAFAPGATFSLKIRALQDHYLIIVNNAVYTDYKYRIDPESVTRLYVSGRIKLFNVLYRCP 957
Fly 958 SLIVSMERMHWRQMGGHIKRI----FNSGVDVVWGISCDNTGWVYNGGWGGMFLKGLEGSGKINP 1018
Fly 1019 MI-DTHTYYVY 1028 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Pex23 | NP_730508.1 | DysFN | 64..125 | CDD:214777 | |
| Hyd_WA | 210..238 | CDD:283993 | |||
| Hyd_WA | 257..282 | CDD:283993 | |||
| TECPR | 280..320 | CDD:214782 | |||
| TECPR | 338..371 | CDD:214782 | |||
| PH-like | 639..759 | CDD:302622 | |||
| Gal-bind_lectin | 815..954 | CDD:278752 | 33/125 (26%) | ||
| TECPR | 966..1000 | CDD:214782 | 8/37 (22%) | ||
| DysFN | 1021..1081 | CDD:214777 | 4/8 (50%) | ||
| DysFC | 1092..>1113 | CDD:128935 | |||
| Hyd_WA | 1165..1192 | CDD:283993 | |||
| Hyd_WA | 1209..1237 | CDD:283993 | |||
| Hyd_WA | 1308..1333 | CDD:283993 | |||
| lec-8 | NP_509649.1 | GLECT | 14..138 | CDD:214596 | 35/150 (23%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3587 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||