DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex23 and F46A8.3

DIOPT Version :10

Sequence 1:NP_730508.1 Gene:Pex23 / 40229 FlyBaseID:FBgn0288469 Length:1350 Species:Drosophila melanogaster
Sequence 2:NP_492885.1 Gene:F46A8.3 / 173018 WormBaseID:WBGene00009746 Length:228 Species:Caenorhabditis elegans


Alignment Length:188 Identity:38/188 - (20%)
Similarity:63/188 - (33%) Gaps:52/188 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   675 TDTNSSENSRSGDSGTFTVLSPDGAATKIQFPLSDITCVQCCSEAGAPRIAIHAPHLPVNCSPVK 739
            |.::|||..|....|        |...|.....||    ......|..|   ..|..|...:|  
 Worm    37 TSSSSSEEHRYRPRG--------GKRPKFDDDSSD----DYSGRRGGGR---QRPPRPPRPAP-- 84

  Fly   740 LQFSSDSEMEDWLSHLSSVCSQINTMVGKPAGNAIWITSELGDVFVFDPA-----NMKAHQT--- 796
                :....|||:    ::.....|.:..|.|  .|.|.::..::....:     |:...||   
 Worm    85 ----TPKPREDWI----TINGPFTTTLPIPGG--YWDTGKIMRIYGIPGSGRWTINLAKSQTWVF 139

  Fly   797 ---SEPSEGYVEK---------MDVSTCETPYY-NTLYN----GMPCGTELEISGCVY 837
               .||::|.|.:         :..:..|.|:. ||.:|    ..|...|:.::|..:
 Worm   140 HFACEPTKGLVARTRHTNGAWEVGETYSENPFQANTQFNVTMVNQPTHIEIHVNGAFF 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex23NP_730508.1 DysFN 64..125 CDD:214777
Tectonin 210..398 CDD:465992
PH-like 639..759 CDD:473070 18/83 (22%)
Gal-bind_lectin 821..953 CDD:459768 4/21 (19%)
TECPR 966..1000 CDD:214782
DysFN 1021..1081 CDD:214777
DysFC 1092..>1113 CDD:128935
Tectonin <1165..1333 CDD:465992
F46A8.3NP_492885.1 GLECT 102..227 CDD:214596 19/98 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.