DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex23 and zgc:173443

DIOPT Version :9

Sequence 1:NP_730508.1 Gene:Pex23 / 40229 FlyBaseID:FBgn0052226 Length:1350 Species:Drosophila melanogaster
Sequence 2:NP_001103326.2 Gene:zgc:173443 / 100126130 ZFINID:ZDB-GENE-071004-101 Length:256 Species:Danio rerio


Alignment Length:187 Identity:44/187 - (23%)
Similarity:76/187 - (40%) Gaps:39/187 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 LAQISVGPTGLVWA-------VLHNGRVIVRTGVTR------DNLV----------------GDS 281
            |...||||.|.:..       .|.:||.:...|:.:      |.::                .:.
Zfish    64 LKHFSVGPAGQLGVNKTYYIFKLMSGRFVGFPGLLKQVDAGGDQIIAGVNMNDDIFCLNMDASNH 128

  Fly   282 WLDVKTPVAASSLRIVHVSVGTDAVWCVTNDHHAWFRRGVKGEAAGISEDSAIGKG-WVEMVGNI 345
            |....||....:.::.:.|.|..:.|.|.:|.|.:..:||       |.::..|.| :|.:.|.:
Zfish   129 WPSSTTPWVTLNGKLKYYSCGPYSCWGVNSDDHIFIMKGV-------SSNACSGDGTFVNIPGLL 186

  Fly   346 SMVSVAANDQVFAIGAADRCLYHRSGVTSADPTGKKW-RLIQCPMQISRTSSSLSIV 401
            ||:.|..:..||.:....: |:.|.||:.::|.|..| .:|.||......|..|.::
Zfish   187 SMIEVGTDGSVFGVNYEAK-LFQRVGVSRSNPAGTDWISMIACPNGHKHVSFDLGVL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex23NP_730508.1 DysFN 64..125 CDD:214777
Hyd_WA 210..238 CDD:283993
Hyd_WA 257..282 CDD:283993 5/53 (9%)
TECPR 280..320 CDD:214782 9/39 (23%)
TECPR 338..371 CDD:214782 9/32 (28%)
PH-like 639..759 CDD:302622
Gal-bind_lectin 815..954 CDD:278752
TECPR 966..1000 CDD:214782
DysFN 1021..1081 CDD:214777
DysFC 1092..>1113 CDD:128935
Hyd_WA 1165..1192 CDD:283993
Hyd_WA 1209..1237 CDD:283993
Hyd_WA 1308..1333 CDD:283993
zgc:173443NP_001103326.2 Hyd_WA 197..225 CDD:283993 9/28 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23250
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.