DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FRG1 and Frg1l1

DIOPT Version :9

Sequence 1:NP_649202.1 Gene:FRG1 / 40228 FlyBaseID:FBgn0036964 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001070964.1 Gene:Frg1l1 / 689484 RGDID:1592278 Length:258 Species:Rattus norvegicus


Alignment Length:266 Identity:127/266 - (47%)
Similarity:171/266 - (64%) Gaps:12/266 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDYDHARIKKLVLKGEKLKKSKKRKKEKDEAGSSKKAKVVVDEDAVKH--GGWWAAKTAADITG 63
            |::|.:.:..||||||.|.|..||:.|:       ||.|...||:|...  |.||......:|:|
  Rat     1 MAEYSYVKSTKLVLKGTKAKSKKKKSKD-------KKRKREEDEEAQLDIVGIWWTVSNFGEISG 58

  Fly    64 TVSIEFGDRSYLKAMDNGLFTLGAPHNAGD-GPDPEEIFTAFPINDRKVAFKSGYGKYLKIEKDG 127
            |::||....:|:.|:|||||||||||...| |..|.|.|||..::|.::|.||||||||.|..||
  Rat    59 TIAIEMDKGAYIHALDNGLFTLGAPHREVDEGSSPPEQFTAVKLSDSRIALKSGYGKYLGINSDG 123

  Fly   128 MVTGRSEAVGGMEQWEPVFEEQRMALLSETGHFMSIDPQDDACVALRKKVGQHEICKVRSNASRD 192
            :|.|||:|:|..|||||||::.:||||:....|:..:...| ..|..|..|:.|:.|:||.|.|:
  Rat   124 LVVGRSDAIGPREQWEPVFQDGKMALLASNSCFIRCNEAGD-IEAKNKTAGEEEMIKIRSCAERE 187

  Fly   193 V-VIDTEPKEEKGDLGEVEKNYVKKFQKFQDKKMRINQNDVKELEQAKAQGSLHETLLDRRSKMK 256
            . ..|...:|:||.:.:.|.|||||||.|||.|::|::.|.|.|::|:..|.|||||||||:|:|
  Rat   188 AKKKDDIAEEDKGSVQQCEINYVKKFQSFQDHKLKISKEDSKILKKARKDGFLHETLLDRRAKLK 252

  Fly   257 ADRYCK 262
            ||||||
  Rat   253 ADRYCK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FRG1NP_649202.1 FRG1 72..260 CDD:283809 96/189 (51%)
Frg1l1XP_001070964.1 FRG1 67..256 CDD:368803 96/189 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3295
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1400930at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.