DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FRG1 and frg1

DIOPT Version :9

Sequence 1:NP_649202.1 Gene:FRG1 / 40228 FlyBaseID:FBgn0036964 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_595824.1 Gene:frg1 / 2541328 PomBaseID:SPBP23A10.12 Length:245 Species:Schizosaccharomyces pombe


Alignment Length:275 Identity:65/275 - (23%)
Similarity:106/275 - (38%) Gaps:59/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KLVLKGEKLKKSKKRKKEKDEAGSSKKAKVVVDEDAVKHGGWWAAKTAADITGTVSIEFGDRSYL 75
            :|..||:| |..||:||......||.       |.|.....|..|....::.|...|       .
pombe     4 RLTFKGDK-KIQKKKKKNTKSLQSSL-------ESAENDPFWTDANELNELEGPAVI-------Y 53

  Fly    76 KAMDNGLFTLGAPHNAGD---------GPDPE---EIFTAFPINDRKVAFKSGYGKYLKIEKDGM 128
            |..|:...:||.......         ..:||   ::|....:|: .:..||..|||:...|.|.
pombe    54 KIDDDAGVSLGIEEVKESCVLLPLDKVSLEPELTRQVFLLSILNN-TILLKSCLGKYMSCSKSGD 117

  Fly   129 VTGRSEAVGGMEQ------------WEPVFEEQRMALLSETGHFMSIDPQDDACVALRKKVGQHE 181
            :....||||..||            |:.|..::.:.|        |.:.||.|...:...|....
pombe   118 LYCTQEAVGSQEQWIAENLGSGFWAWKSVSTKKYLTL--------SREKQDQAIACVSDTVIPEA 174

  Fly   182 ICKVRSNASRDVVIDTE-PKEEKGDLGEVEKNYVKKFQKFQDKKMRINQNDVKELEQAKAQGSLH 245
            ..::|        :.|. .|:.|..|.:....:.::.:....:|  ::.::.|.|::|..:|.||
pombe   175 KWRIR--------VQTRFLKKNKSSLFDNPTIHSRQLESMAGRK--LSTDEKKTLKKAFKEGVLH 229

  Fly   246 ETLLDRRSKMKADRY 260
            |.|||.|...::|:|
pombe   230 EALLDLRVSSRSDKY 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FRG1NP_649202.1 FRG1 72..260 CDD:283809 47/212 (22%)
frg1NP_595824.1 Fascin 83..244 CDD:304938 43/179 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3962
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006139
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105059
Panther 1 1.100 - - LDO PTHR12928
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R457
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.