DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and CanA-14F

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster


Alignment Length:388 Identity:106/388 - (27%)
Similarity:174/388 - (44%) Gaps:77/388 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 AAGRKNQYQGSAHV----------SVLDDKDDLVEEF----------GDIVNAKIELP---IRKN 188
            :||.:.|.||....          |.:..|:.:::..          .|:.:|:...|   :.|.
  Fly    58 SAGTQQQGQGGTGTSSGPSSPTKRSTISTKERVIDSVAFPPSRKLTCADVFDARTGKPQHDVLKQ 122

  Fly   189 HIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLV 253
            |..|         ..|:.......|::|.|..|:    .......:...||||||:||:..||:.
  Fly   123 HFIL---------EGRIEESAALRIIQEGATLLR----TEKTMIDIEAPVTVCGDIHGQFYDLMK 174

  Fly   254 VLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIR 318
            :....|.|:::. |:|.||:||||...:|.:|.|.||.:.:|..:||.|||||...:...:.|.:
  Fly   175 LFEIGGSPATTK-YLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQ 238

  Fly   319 EVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFS-DSTSLDLIKSIDRGKYVSILRP 382
            |.:.||   .:|:.....:.:..|||.:::|.:.|.||||.| :...|:.|:.:||.|     .|
  Fly   239 ECKIKY---SERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFK-----EP 295

  Fly   383 PLTDGEPLDKTEWQQIFDIMWSDPQATMG-------CVPNTLRGAGVWFGPDVTDNFLQRHRLSY 440
            |          .:..:.|::||||....|       ...|::||...::......:|||.:.|..
  Fly   296 P----------AFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLS 350

  Fly   441 VIRSHECKPNGHEFMHDNK------IITIFSASNYYAIGSNKGAYIRLNNQLM--------PH 489
            :||:||.:..|:.....::      :||||||.||..:.:||.|.::..|.:|        ||
  Fly   351 IIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPH 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 97/331 (29%)
EFh 616..681 CDD:238008
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 97/331 (29%)
PP2Ac 132..403 CDD:197547 89/293 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.