DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and PPH3

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_010360.1 Gene:PPH3 / 851647 SGDID:S000002482 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:293 Identity:102/293 - (34%)
Similarity:158/293 - (53%) Gaps:27/293 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 ILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRG 277
            :.|....|.:.|.|...| |.|...||:|||:||:|.|||.:..|:|....:. |:|.|||||||
Yeast    22 VFRLCLNSQELLMNEGNV-TQVDTPVTICGDIHGQLHDLLTLFEKSGGVEKTR-YIFLGDFVDRG 84

  Fly   278 KRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWL 342
            ...||..||||...|.:|:.:.|.|||||...:...|||..||..||  .:..:..:..||:.:|
Yeast    85 FYSLESFLLLLCYKLRYPDRITLIRGNHETRQITKVYGFYDEVVRKY--GNSNVWRYCCEVFDYL 147

  Fly   343 PLGSVLNSRVLIVHGGFS-DSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDP 406
            .||:::|:.:..||||.| |.|::|.|::|||.:.|.      .:|         .:.|::||||
Yeast   148 SLGAIINNSIFCVHGGLSPDMTTVDEIRTIDRKQEVP------HEG---------AMCDLLWSDP 197

  Fly   407 Q--ATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNY 469
            :  .|....|   ||||..||....|.||:::.:..:.|:|:....|::.|.|..::|::||.||
Yeast   198 EDVDTWSLSP---RGAGFLFGKREVDQFLEKNNVELIARAHQLVMEGYKEMFDGGLVTVWSAPNY 259

  Fly   470 -YAIGSNKGAYIRLNNQLMPHFVQYISAASQTK 501
             |..| |..|.:::::.|...:..:.:..:|.:
Yeast   260 CYRCG-NVAAVLKIDDDLNREYTIFEAVQAQNE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 101/284 (36%)
EFh 616..681 CDD:238008
PPH3NP_010360.1 MPP_PP2A_PP4_PP6 3..286 CDD:277360 101/286 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.