DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and PPH21

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_010147.1 Gene:PPH21 / 851421 SGDID:S000002292 Length:369 Species:Saccharomyces cerevisiae


Alignment Length:335 Identity:98/335 - (29%)
Similarity:168/335 - (50%) Gaps:35/335 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 DDLVEEFGDIVNAKIELPIRKNH-----IDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPN 226
            |||......|.:.|...|:..|:     :|..|:...|  ...|....||.:.:.|...|:...|
Yeast    42 DDLKPGSSGIADHKSSKPLELNNTNINQLDQWIEHLSK--CEPLSEDDVARLCKMAVDVLQFEEN 104

  Fly   227 ISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLY 291
            :.|::.    .||:|||:||:..||| .|.|.|.|.....|:|.||:||||...:|.:..|:::.
Yeast   105 VKPINV----PVTICGDVHGQFHDLL-ELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMK 164

  Fly   292 LAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVH 356
            :.:|:.:.:.|||||...:...|||..|...||  ....:.....:::.:.|:.:::::::..:|
Yeast   165 VRYPHRITILRGNHESRQITQVYGFYDECLRKY--GSANVWKMFTDLFDYFPITALVDNKIFCLH 227

  Fly   357 GGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDP--QATMGCVPNTLRG 419
            ||.|     .:|::||:.:.::.::....:|         .:.|::||||  :...|..|   ||
Yeast   228 GGLS-----PMIETIDQVRELNRIQEVPHEG---------PMCDLLWSDPDDRGGWGISP---RG 275

  Fly   420 AGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNY-YAIGSNKGAYIRLN 483
            ||..||.||::.|...:.||.:.|:|:....|:.:.|...::|||||.|| |..| |:.|.:.::
Yeast   276 AGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFSAPNYCYRCG-NQAAIMEVD 339

  Fly   484 NQLMPHFVQY 493
            ......|:||
Yeast   340 ENHNRQFLQY 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 93/318 (29%)
EFh 616..681 CDD:238008
PPH21NP_010147.1 MPP_PP2A_PP4_PP6 70..352 CDD:277360 91/307 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341461
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.