DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and PP7

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_851258.2 Gene:PP7 / 836507 AraportID:AT5G63870 Length:413 Species:Arabidopsis thaliana


Alignment Length:329 Identity:117/329 - (35%)
Similarity:155/329 - (47%) Gaps:76/329 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 QLPNISPVSTAVS------------------------QQVTVCGDLHGKLDDLLVVLHKNGLPSS 263
            |||::.||:...|                        ..|.|.||:||:|.|||.:|...|.|..
plant    40 QLPSLLPVNVFDSLVLTAHKILHKERNCVHIDDLDSVSNVVVVGDIHGQLHDLLFLLKDTGFPCQ 104

  Fly   264 SNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNH 328
            :..||||||:||||..|||..|:|||..:..|:.|:|.|||||.....:.|||.:||.:||....
plant   105 NRCYVFNGDYVDRGAWGLETFLVLLSWKVLMPDRVYLLRGNHESKYCTSMYGFEKEVLTKYGDKG 169

  Fly   329 KRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGK---YVSILRPPLTDGEP- 389
            |.:.......:..|||.|:::.||...|||...|..|.  |...|||   .|.:|.|     || 
plant   170 KHVYRKCLGCFEGLPLASIISGRVYTAHGGLFRSPVLP--KRTTRGKKNRRVVLLEP-----EPS 227

  Fly   390 ------LDK----------TEWQQI----FDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQ 434
                  ||:          ..|:..    .|::||||..|.|..||..||.|:.:|||.|::||:
plant   228 SMKLGTLDELMQARRSVLDPPWEGSNLIPGDVLWSDPSMTPGLSPNEQRGIGLLWGPDCTEDFLK 292

  Fly   435 RHRLSYVIRSHE------------CKPNGHEFMHD---NKIITIFSASNYYAIGS------NKGA 478
            ::.|..:|||||            ...||:...|:   .|:||||||.:|....:      ||||
plant   293 KYELKLIIRSHEGPDAREKRTGLGGMDNGYTIDHNVESGKLITIFSAPDYPQFQATEERYKNKGA 357

  Fly   479 YIRL 482
            ||.|
plant   358 YIIL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 117/329 (36%)
EFh 616..681 CDD:238008
PP7NP_851258.2 MPP_PP7 11..388 CDD:163661 117/329 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.