DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and Ppp6c

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_077171.1 Gene:Ppp6c / 67857 MGIID:1915107 Length:305 Species:Mus musculus


Alignment Length:296 Identity:99/296 - (33%)
Similarity:145/296 - (48%) Gaps:65/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 KYVALILREAAKSLKQLP-------------------NISPVSTAVSQQVTVCGDLHGKLDDLLV 253
            |||     |.|:..|.||                   |:.||||    .||||||:||:..||..
Mouse     8 KYV-----EIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVST----PVTVCGDIHGQFYDLCE 63

  Fly   254 VLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIR 318
            :....|....:| |:|.|||||||...||....||:|...:|:.:.|.|||||...:...|||..
Mouse    64 LFRTGGQVPDTN-YIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYD 127

  Fly   319 EVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFS-DSTSLDLIKSIDRGKYVSILRP 382
            |.::||  .:.....:..:|:..|.:.::::.::|.||||.| |..:||.|::|:|.        
Mouse   128 ECQTKY--GNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERN-------- 182

  Fly   383 PLTDGEPLDKTEWQQI------FDIMWSDPQ--ATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLS 439
                         |:|      .|::||||:  .|....|   ||||..||..||:.|:..:.|.
Mouse   183 -------------QEIPHKGAFCDLVWSDPEDVDTWAISP---RGAGWLFGAKVTNEFVHINNLK 231

  Fly   440 YVIRSHECKPNGHEFMHDNKIITIFSASNY-YAIGS 474
            .:.|:|:....|::||.|.|::|::||.|| |..|:
Mouse   232 LICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 99/296 (33%)
EFh 616..681 CDD:238008
Ppp6cNP_077171.1 MPP_PP2A_PP4_PP6 5..289 CDD:277360 99/296 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.